1P9J: PDB entry 1P9J

Solution structure and dynamics of the EGF/TGF-alpha chimera T1E. Determined by solution NMR. Released 7 Oct 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 442
Mol. weight: 6.34 kDa
Released: 7 Oct 2003

Explore 1P9J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1P9J contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	21-25	5	1
β-strand	30-34	5	1
α-helix	35-36	2
β-strand	39-40	2	2
β-strand	46-47	2	2
α-helix	48	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
chimera of Epidermal growth factor(EGF) and Transforming growth factor alpha (TGF-alpha)	A	protein	54	Homo sapiens	P01133 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1P9J_1 chimera of Epidermal growth factor(EGF) and Transforming growth factor alpha (TGF-alpha) (chains A)
VVSHFNDCPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWEL

Primary citation

Structural Analysis of an Epidermal Growth Factor/Transforming Growth Factor-alpha Chimera with Unique ErbB Binding Specificity. Wingens, M., Walma, T., Van Ingen, H. et al. J Biol Chem (2003) 278:39114-39123. DOI 10.1074/jbc.M305603200 · PubMed

Other PDB entries of the same protein (UniProt P01133 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NQL 2.8 Å, Structure of the extracellular domain of human epidermal growth factor (EGF) receptor in…
1JL9 3.0 Å, Crystal Structure of Human Epidermal Growth Factor
7SYD 3.1 Å, Cryo-EM structure of the extracellular module of the full-length EGFR bound to EGF…
1IVO 3.3 Å, Crystal Structure of the Complex of Human Epidermal Growth Factor and Receptor…
7SYE 3.3 Å, Cryo-EM structure of the extracellular module of the full-length EGFR bound to EGF.…
7SZ0 3.3 Å, Cryo-EM structure of the extracellular module of the full-length EGFR L834R bound to…
3NJP 3.3 Å, The Extracellular and Transmembrane Domain Interfaces in Epidermal Growth Factor…
8HGO 3.31 Å, The EGF-bound EGFR/HER2 ectodomain complex
7SZ1 3.4 Å, Cryo-EM structure of the extracellular module of the full-length EGFR L834R bound to…
8HGS 3.81 Å, The EGF-bound EGFR ectodomain homodimer
7OM4 6.05 Å, Nanobody EgB4 bound to the full extracellular EGFR-EGF complex
2KV4 EGF

Browse structure collections

About this viewer

MolViewer shows 1P9J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.