1PBW: BCR-homology (BH) domain

Structure of BCR-homology (BH) domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 12 Mar 1997.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,284
Mol. weight: 48.61 kDa
Released: 12 Mar 1997

Explore 1PBW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1PBW contains 23 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	118-121	4
α-helix	130-143	14
α-helix	160-164	5
α-helix	174-176	3
β-strand	177	1	1
α-helix	179-191	13
α-helix	200-209	10
α-helix	210-212	3
α-helix	216-227	12
α-helix	234-252	19
α-helix	254-257	4
α-helix	261-273	13
α-helix	280-295	16

Chain B: 11 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	118-121	4
α-helix	130-143	14
α-helix	158-165	8
β-strand	167	1	2
β-strand	169	1	2
α-helix	174-176	3
β-strand	177	1	1
α-helix	179-192	14
α-helix	200-208	9
α-helix	216-227	12
α-helix	235-251	17
α-helix	254-257	4
α-helix	261-272	12
α-helix	284-295	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 3-kinase	A, B	protein	216	Homo sapiens	P27986 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1PBW_1 PHOSPHATIDYLINOSITOL 3-KINASE (chains A, B)
MEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQ
LLDCDTPSVDLEMIDVHVLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLL
KKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNT
ENLIKVIEILISTEWNERQPAPALPPKPPKPTTVAN

Primary citation

Crystal structure of the breakpoint cluster region-homology domain from phosphoinositide 3-kinase p85 alpha subunit. Musacchio, A., Cantley, L.C., Harrison, S.C. Proc Natl Acad Sci U S A (1996) 93:14373-14378. DOI 10.1073/pnas.93.25.14373 · PubMed

Other PDB entries of the same protein (UniProt P27986 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GJI 0.9 Å, PI3K p85 N-terminal SH2 domain/CD28-derived peptide complex
5AUL 1.1 Å, PI3K p85 C-terminal SH2 domain/CD28-derived peptide complex
7CIO 1.1 Å, Molecular interactions of cytoplasmic region of CTLA-4 with SH2 domains of PI3-kinase
7RNS 1.14 Å, nSH2 domain of p85-alpha subunit of phosphatidylinositol 3-kinase in complex with an…
3I5R 1.7 Å, PI3K SH3 domain in complex with a peptide ligand
1H9O 1.79 Å, Phosphatidylinositol 3-kinase, P85-alpha subunit: C-terminal SH2 domain complexed with a…
2IUG 1.89 Å, Crystal structure of the PI3-kinase p85 N-terminal SH2 domain
1PHT 2.0 Å, Phosphatidylinositol 3-kinase P85-alpha subunit SH3 domain, residues 1-85
2IUH 2.0 Å, Crystal structure of the PI3-kinase p85 N-terminal SH2 domain in complex with c-Kit…
4JPS 2.2 Å, Co-crystal Structures of the Lipid Kinase PI3K alpha with Pan and Isoform Selective…
7PG5 2.2 Å, Crystal Structure of PI3Kalpha
6PYR 2.21 Å, Human PI3Kdelta in complex with Compound 2-10 ((3S)-3-benzyl-3-methyl-5-[5-(2-methylpyrim…

Browse structure collections

About this viewer

MolViewer shows 1PBW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.