1PD7: Extended SID of Mad1

Extended SID of Mad1 bound to the PAH2 domain of mSin3B. Determined by solution NMR. Released 20 Jan 2004.

Method: Solution NMR
Organism: Mus musculus
Chains: 2
Atoms: 921
Mol. weight: 13.08 kDa
Released: 20 Jan 2004

Explore 1PD7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1PD7 contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	5-20	16
α-helix	27-39	13
α-helix	41-44	4
α-helix	55-66	12
α-helix	70-76	7

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	203-220	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sin3b protein	A	protein	85	Mus musculus	Q62141 (AlphaFold model)
Mad1	B	protein	24		Q05195 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1PD7_1 Sin3b protein (chains A)
ESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFT
EVANLFRGQEDLLSEFGQFLPEAKR

Sequence of entity 2 (B), FASTA

>1PD7_2 Mad1 (chains B)
VRMNIQMLLEAADYLERREREAEH

Primary citation

Extension of the binding motif of the sin3 interacting domain of the mad family proteins(,). Van Ingen, H., Lasonder, E., Jansen, J.F. et al. Biochemistry (2004) 43:46-54. PubMed

Other PDB entries of the same protein (UniProt Q62141 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1E91 Structure of the complex of the Mad1-Sin3B interaction domains
2CR7 Solution structure of the first PAH domain of the mouse transcriptional repressor SIN3B
2CZY Solution structure of the NRSF/REST-mSin3B PAH1 complex
2F05 Solution structure of free PAH2 domain of mSin3B
5Y95 Haddock model of mSIN3B PAH1 domain

Browse structure collections

About this viewer

MolViewer shows 1PD7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.