1PFH: Phospho-hpr

The phosphorylated form of the histidine-containing phosphocarrier protein hpr. Determined by solution NMR. Released 14 Nov 1995.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 644
Mol. weight: 9.21 kDa
Released: 14 Nov 1995

Explore 1PFH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1PFH contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
α-helix	17-26	10
β-strand	34-37	4	1
β-strand	40-43	4	1
α-helix	47-51	5
β-strand	60-65	6	1
α-helix	70-83	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phospho-hpr	A	protein	85	Escherichia coli	P0AA04 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1PFH_1 PHOSPHO-HPR (chains A)
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTV
VTISAEGEDEQKAVEHLVKLMAELE

Primary citation

High-resolution structure of the phosphorylated form of the histidine-containing phosphocarrier protein HPr from Escherichia coli determined by restrained molecular dynamics from NMR-NOE data. van Nuland, N.A., Boelens, R., Scheek, R.M. et al. J Mol Biol (1995) 246:180-193. DOI 10.1006/jmbi.1994.0075 · PubMed

Other PDB entries of the same protein (UniProt P0AA04 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CCD 1.0 Å, 1.0 A Structure of Post-Succinimide His15Asp HPr
1OPD 1.5 Å, Histidine-containing protein (HPR), mutant with ser 46 replaced by asp (S46D)
1CM3 1.6 Å, HIS15ASP hpr from E. Coli
1CM2 1.8 Å, Structure of HIS15ASP hpr after hydrolysis of ringed species.
1POH 2.0 Å, The 2.0 Å resolution structure of escherichia coli histidine-containing phosphocarrier…
9S8K 2.06 Å, Structure of glycogen phosphorylase - tetrameric form - in complex with HPr from…
4XWJ 2.1 Å, Histidine-containing phosphocarrier protein (HPr) and antisigma factor Rsd complex
2JEL 2.5 Å, JEL42 fab/hpr complex
5YA1 2.7 Å, crystal structure of LsrK-HPr complex with ATP
5YA2 2.7 Å, Crystal structure of LsrK-HPr complex with ADP
9S8B 2.79 Å, Structure of glycogen phosphorylase - dimeric form - in complex with HPr from…
5YA0 3.0 Å, Crystal structure of LsrK and HPr complex

Browse structure collections

About this viewer

MolViewer shows 1PFH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.