1POH: Histidine-containing phosphocarrier protein hpr

The 2.0 Å resolution structure of escherichia coli histidine-containing phosphocarrier protein hpr: a redetermination. Determined by X-ray diffraction at 2.0 Å resolution. Released 31 Jan 1994.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Escherichia coli
Chains: 1
Atoms: 739
Mol. weight: 9.32 kDa
Released: 31 Jan 1994

Explore 1POH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1POH contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
α-helix	16-26	11
β-strand	32-37	6	1
β-strand	40-43	4	1
α-helix	47-50	4
β-strand	60-66	7	1
α-helix	70-83	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histidine-containing phosphocarrier protein hpr	A	protein	85	Escherichia coli	P0AA04 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1POH_1 HISTIDINE-CONTAINING PHOSPHOCARRIER PROTEIN HPR (chains A)
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTV
VTISAEGEDEQKAVEHLVKLMAELE

Primary citation

The 2.0-A resolution structure of Escherichia coli histidine-containing phosphocarrier protein HPr. A redetermination. Jia, Z., Quail, J.W., Waygood, E.B. et al. J Biol Chem (1993) 268:22490-22501. PubMed

Other PDB entries of the same protein (UniProt P0AA04 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CCD 1.0 Å, 1.0 A Structure of Post-Succinimide His15Asp HPr
1OPD 1.5 Å, Histidine-containing protein (HPR), mutant with ser 46 replaced by asp (S46D)
1CM3 1.6 Å, HIS15ASP hpr from E. Coli
1CM2 1.8 Å, Structure of HIS15ASP hpr after hydrolysis of ringed species.
9S8K 2.06 Å, Structure of glycogen phosphorylase - tetrameric form - in complex with HPr from…
4XWJ 2.1 Å, Histidine-containing phosphocarrier protein (HPr) and antisigma factor Rsd complex
2JEL 2.5 Å, JEL42 fab/hpr complex
5YA1 2.7 Å, crystal structure of LsrK-HPr complex with ATP
5YA2 2.7 Å, Crystal structure of LsrK-HPr complex with ADP
9S8B 2.79 Å, Structure of glycogen phosphorylase - dimeric form - in complex with HPr from…
5YA0 3.0 Å, Crystal structure of LsrK and HPr complex
6KCR 3.5 Å, X-ray structure of the MtlR-HPr complex from Escherichia coli

Browse structure collections

About this viewer

MolViewer shows 1POH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.