1Q0Y: Anti-Morphine Antibody 9B1

Anti-Morphine Antibody 9B1 Complexed with Morphine. Determined by X-ray diffraction at 2.0 Å resolution. Released 20 Apr 2004.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,524
Mol. weight: 46.44 kDa
Ligands: MOI
Released: 20 Apr 2004

Explore 1Q0Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q0Y contains 14 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
β-strand	10-12	3	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	33-39	7	7
β-strand	45-52	8	7
β-strand	56-59	4	7
α-helix	61-63	3
β-strand	67-72	6	6
β-strand	77-82	6	6
α-helix	84-86	3
β-strand	88-96	9	7
β-strand	100A-103	5	7
β-strand	107-111	5	7
β-strand	117	1	8
β-strand	120-124	5	9
β-strand	137-147	11	9
β-strand	148	1	8
β-strand	153-157	4	10
α-helix	158-164	3
β-strand	166	1	10
β-strand	170-173	3	9
α-helix	174-176	3
β-strand	177-179	3	9
β-strand	184-194	11	9
β-strand	207-212	6	10
α-helix	213-215	3
β-strand	217-222	6	10

Chain L: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
β-strand	9-13	4	2
β-strand	19-25	7	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	43-49	7	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-92	9	2
β-strand	95-98	4	2
β-strand	102-106	5	2
β-strand	111	1	3
α-helix	112-113	2
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	153-155	3	5
β-strand	159-161	3	4
α-helix	162-164	3
β-strand	165-166	2	4
β-strand	173-182	10	4
α-helix	183-186	4
β-strand	191-198	8	5
β-strand	201-210	8	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab 9B1, Light chain	L	protein	212	Mus musculus	P01724 (AlphaFold model)
Fab 9B1, Heavy chain	H	protein	221	Mus musculus	Q9D9B8 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1Q0Y_1 Fab 9B1, Light chain (chains L)
DAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGV
PARFSGSLIGDKAALTITGAQTEDEAIYFCALWSNNKLVFGGGTKLTVLGQPKSSPTVTL
FPPSSEELSTAKATLVCTITDFYPGVVTVDWKVDGTPVTAGMETTQPSKQSNNKYMASSY
LTLTARAWERHSSYSCQVTHEGHSSNKTLSRA

Sequence of entity 2 (H), FASTA

>1Q0Y_2 Fab 9B1, Heavy chain (chains H)
EVQLQQSGAELMKPGASVKISCKATGYTFSSYWIEWVKQRPGHGLEWIGEILPGSGDTIF
NEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARWVLDYYGMDYWGQGTSLTVSSA
STTPPSVYPLAPGGXXXXXXSAMVTLGCLVKGYFPEPVTVVWNKGSLSTGTHTFPAVLAA
DLYTLSSSVTVSASSWPGQSVTCNVAHPASSTKVDKKIAPS

Ligands and cofactors

ID	Name	Formula	Copies
MOI	(7R,7AS,12BS)-3-methyl-2,3,4,4A,7,7A-hexahydro-1H-4,12-METHANO[1]BENZOFURO[3,2-…	C17 H19 N O3	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Anchoring a cationic ligand: the structure of the Fab fragment of the anti-morphine antibody 9B1 and its complex with morphine. Pozharski, E., Wilson, M.A., Hewagama, A. et al. J Mol Biol (2004) 337:691-697. DOI 10.1016/j.jmb.2003.12.084 · PubMed

Other PDB entries of the same protein (UniProt P01724 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OAQ 1.5 Å, Free conformation Ab1 of the IgE SPE-7
1A6V 1.8 Å, B1-8 FV fragment complexed with a (4-hydroxy-3-nitrophenyl) acetate compound
1OAU 1.8 Å, Fv Structure of the IgE SPE-7 in complex with DNP-Ser (immunising hapten)
1A6W 2.0 Å, B1-8 fv fragment complexed with a (4-hydroxy-5-iodo-3-nitrophenyl) acetate compound
1OCW 2.0 Å, Free conformation Ab2 of the IgE SPE-7
1A6U 2.1 Å, B1-8 fv fragment
2BJM 2.15 Å, SPE7:Anthrone Complex
1OAR 2.23 Å, Fv IgE SPE-7 in complex with Alizarin Red
1DL7 2.35 Å, The structural basis of repertoire shift in an immune response to phosphocholine
1OAY 2.66 Å, Antibody multispecificity mediated by conformational diversity
1OAX 2.67 Å, Fv Structure of the IgE SPE-7 in complex with acenaphthenequinone
1OAZ 2.78 Å, IgE Fv SPE7 complexed with a recombinant thioredoxin

Browse structure collections

About this viewer

MolViewer shows 1Q0Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.