1Q3L: Chromodomain Of HP1

Chromodomain Of HP1 Complexed With Histone H3 Tail Containing monomethyllysine 9. Determined by X-ray diffraction at 1.64 Å resolution. Released 12 Oct 2004.

Method: X-ray diffraction
Resolution: 1.64 Å
Organism: Drosophila melanogaster
Chains: 2
Atoms: 593
Mol. weight: 10.33 kDa
Released: 12 Oct 2004

Explore 1Q3L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q3L contains 3 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	24-25	2	1
β-strand	26-35	10	2
β-strand	38-45	8	2
α-helix	50-52	3
β-strand	54-57	4	2
α-helix	58-60	3
β-strand	61-62	2	1
α-helix	64-73	10

Chain P: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6-7	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heterochromatin protein 1	A	protein	69	Drosophila melanogaster	P05205 (AlphaFold model)
Histone H3	P	protein	16		P68431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Q3L_1 Heterochromatin protein 1 (chains A)
MKKHHHHHHAEEEEEEYAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLI
QQYEASRKD

Sequence of entity 2 (P), FASTA

>1Q3L_2 Histone H3 (chains P)
ARTKQTARKSTGGKAY

Primary citation

Chromodomain Of HP1 Complexed With Histone H3 Tail Containing monomethyllysine 9. Jacobs, S.A., Khorasanizadeh, S. To be published.

Other PDB entries of the same protein (UniProt P05205 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AT0 1.28 Å, Chromodomain HP1 with a p-nitro-L-phenylalanine mutation at position 24 bound to histone…
6MHA 1.5 Å, dHP1 Chromodomain Y24W variant bound to histone H3 peptide containing trimethyllysine
6ASZ 1.52 Å, Chromodomain HP1 with Y24F mutation bound to histone H3 peptide containing trimethyl…
1KNA 2.1 Å, Chromo domain of HP1 complexed with histone H3 tail containing dimethyllysine 9.
3P7J 2.3 Å, Drosophila HP1a chromo shadow domain
1KNE 2.4 Å, Chromo domain of HP1 complexed with histone H3 tail containing trimethyllysine 9

Browse structure collections

About this viewer

MolViewer shows 1Q3L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.