6MHA: DHP1 Chromodomain Y24W variant

dHP1 Chromodomain Y24W variant bound to histone H3 peptide containing trimethyllysine. Determined by X-ray diffraction at 1.5 Å resolution. Released 25 Sept 2019.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Drosophila melanogaster
Chains: 2
Atoms: 570
Mol. weight: 7.29 kDa
Released: 25 Sept 2019

Explore 6MHA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MHA contains 3 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	23-25	3	1
β-strand	26-35	10	2
β-strand	38-45	8	2
α-helix	50-52	3
β-strand	54-57	4	2
α-helix	58-60	3
β-strand	61-62	2	1
α-helix	64-73	10

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	-2-0	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heterochromatin protein 1	A	protein	53	Drosophila melanogaster	P05205 (AlphaFold model)
histone H3 peptide containing trimethyllysine, H3K9me3	B	protein	6	Drosophila melanogaster	P02299 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6MHA_1 Heterochromatin protein 1 (chains A)
EEWAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASR

Sequence of entity 2 (B), FASTA

>6MHA_2 histone H3 peptide containing trimethyllysine, H3K9me3 (chains B)
QTARKS

Primary citation

Thermodynamic consequences of Tyr to Trp mutations in the cation-pi-mediated binding of trimethyllysine by the HP1 chromodomain. Krone, M.W., Albanese, K.I., Guseman, A.J. et al. Chem Sci (2020) 11:3495-3500. DOI 10.1039/D0SC00227E

Other PDB entries of the same protein (UniProt P05205 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AT0 1.28 Å, Chromodomain HP1 with a p-nitro-L-phenylalanine mutation at position 24 bound to histone…
6ASZ 1.52 Å, Chromodomain HP1 with Y24F mutation bound to histone H3 peptide containing trimethyl…
1Q3L 1.64 Å, Chromodomain Of HP1 Complexed With Histone H3 Tail Containing monomethyllysine 9.
1KNA 2.1 Å, Chromo domain of HP1 complexed with histone H3 tail containing dimethyllysine 9.
3P7J 2.3 Å, Drosophila HP1a chromo shadow domain
1KNE 2.4 Å, Chromo domain of HP1 complexed with histone H3 tail containing trimethyllysine 9

Browse structure collections

About this viewer

MolViewer shows 6MHA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.