6ASZ: Chromodomain HP1 with Y24F mutation

Chromodomain HP1 with Y24F mutation bound to histone H3 peptide containing trimethyl lysine. Determined by X-ray diffraction at 1.52 Å resolution. Released 6 Dec 2017.

Method: X-ray diffraction
Resolution: 1.52 Å
Organism: Drosophila melanogaster
Chains: 2
Atoms: 515
Mol. weight: 9.3 kDa
Released: 6 Dec 2017

Explore 6ASZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ASZ contains 3 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	23-25	3	1
β-strand	26-35	10	2
β-strand	38-45	8	2
α-helix	50-52	3
β-strand	54-57	4	2
α-helix	58-60	3
β-strand	61-62	2	1
α-helix	64-73	10

Chain P: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6-8	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heterochromatin protein 1	A	protein	69	Drosophila melanogaster	P05205 (AlphaFold model)
trimethyl lysine histone H3 tail peptide	P	protein	6	Drosophila melanogaster	P02299 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6ASZ_1 Heterochromatin protein 1 (chains A)
MKKHHHHHHAEEEEEEFAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLI
QQYEASRKD

Sequence of entity 2 (P), FASTA

>6ASZ_2 trimethyl lysine histone H3 tail peptide (chains P)
QTARKS

Primary citation

Investigation of Trimethyllysine Binding by the HP1 Chromodomain via Unnatural Amino Acid Mutagenesis. Baril, S.A., Koenig, A.L., Krone, M.W. et al. J Am Chem Soc (2017) 139:17253-17256. DOI 10.1021/jacs.7b09223 · PubMed

Other PDB entries of the same protein (UniProt P05205 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AT0 1.28 Å, Chromodomain HP1 with a p-nitro-L-phenylalanine mutation at position 24 bound to histone…
6MHA 1.5 Å, dHP1 Chromodomain Y24W variant bound to histone H3 peptide containing trimethyllysine
1Q3L 1.64 Å, Chromodomain Of HP1 Complexed With Histone H3 Tail Containing monomethyllysine 9.
1KNA 2.1 Å, Chromo domain of HP1 complexed with histone H3 tail containing dimethyllysine 9.
3P7J 2.3 Å, Drosophila HP1a chromo shadow domain
1KNE 2.4 Å, Chromo domain of HP1 complexed with histone H3 tail containing trimethyllysine 9

Browse structure collections

About this viewer

MolViewer shows 6ASZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.