1Q7I: Hemorrhagic protein-rhodostomin

Structural Analysis of Integrin alpha IIb beta 3- Disintegrin with the AKGDWN Motif. Determined by solution NMR. Released 21 Sept 2004.

Method: Solution NMR
Organism: Calloselasma rhodostoma
Chains: 1
Atoms: 505
Mol. weight: 7.39 kDa
Released: 21 Sept 2004

Explore 1Q7I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q7I contains 0 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	33-34	2	1
β-strand	37-38	2	1
β-strand	43-44	2	2
β-strand	56-57	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hemorrhagic protein-rhodostomin	A	protein	68	Calloselasma rhodostoma	P30403 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Q7I_1 Hemorrhagic protein-rhodostomin (chains A)
GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDWNDDRCTGQ
SADCPRYH

Primary citation

Structure Analysis of Integrin alpha IIb beta 3 - Specific Disintegrin with the ARGDWN Motif. Chuang, W.J., Chen, C.Y., Shiu, J.H. et al. To be published.

Other PDB entries of the same protein (UniProt P30403 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4R5R 0.96 Å, Crystal structure of Rhodostomin KKKRT mutant
3UCI 1.35 Å, Crystal structure of Rhodostomin ARLDDL mutant
7X4V 1.38 Å, Crystal structure of Rhodostomin ARGDDP mutant
7X4Z 1.48 Å, Crystal structure of Rhodostomin ARGDWP mutant
4RQG 1.66 Å, Crystal structure of Rhodostomin
7X4S 1.8 Å, Crystal structure of Rhodostomin ARGDMP mutant
26QZ 1.8 Å, Crystal structure of Rhodostomin ARGDP mutant
4R5U 1.81 Å, Crystal structure of Rhodostomin R46E mutant
9IUJ 2.78 Å, Integrin alpha-v beta-3 in complex with rhodostomin
1N4Y Refined structure of kistrin
1Q7J Structural Analysis of Integrin alpha IIb beta 3- Disintegrin with the AKGDWN Motif
2LJV Solution structure of Rhodostomin G50L mutant

Browse structure collections

About this viewer

MolViewer shows 1Q7I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.