Structural Analysis of Integrin alpha IIb beta 3- Disintegrin with the AKGDWN Motif. Determined by solution NMR. Released 21 Sept 2004.
Explore 1Q7I in 3D Show helices and sheets RCSB PDB PDBe
1Q7I contains 0 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 33-34 | 2 | 1 |
| β-strand | 37-38 | 2 | 1 |
| β-strand | 43-44 | 2 | 2 |
| β-strand | 56-57 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hemorrhagic protein-rhodostomin | A | protein | 68 | Calloselasma rhodostoma | P30403 (AlphaFold model) |
>1Q7I_1 Hemorrhagic protein-rhodostomin (chains A) GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDWNDDRCTGQ SADCPRYH
Structure Analysis of Integrin alpha IIb beta 3 - Specific Disintegrin with the ARGDWN Motif. Chuang, W.J., Chen, C.Y., Shiu, J.H. et al. To be published.
Other PDB entries of the same protein (UniProt P30403 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1Q7I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.