1Q8X: Human cofilin

NMR structure of human cofilin. Determined by solution NMR. Released 6 Jul 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,296
Mol. weight: 18.53 kDa
Released: 6 Jul 2004

Explore 1Q8X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q8X contains 8 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	10-19	10
α-helix	29-31	3
β-strand	33-36	4	1
β-strand	37	1	2
β-strand	38-40	3	1
β-strand	47-56	10	1
α-helix	58-61	4
α-helix	67-73	7
β-strand	81-83	3	2
β-strand	86-90	5	3
β-strand	95-99	5	3
β-strand	100-101	2	4
β-strand	102-104	3	2
α-helix	111-113	3
α-helix	115-128	14
β-strand	133-134	2	4
β-strand	137	1	2
α-helix	140-143	4
α-helix	146-149	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cofilin, non-muscle isoform	A	protein	166	Homo sapiens	P23528 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Q8X_1 Cofilin, non-muscle isoform (chains A)
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV
GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Primary citation

The solution structure of human cofilin: rationalizing actin binding and pH sensitivity. Pope, B.J., Zierler-Gould, K.M., Kuhne, R. et al. J Biol Chem (2004) 279:4840-4848. DOI 10.1074/jbc.M310148200 · PubMed

Other PDB entries of the same protein (UniProt P23528 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9H1F 1.8 Å, Cofilin-1 in complex with high-affinity Sybody B12
9QFJ 2.31 Å, Cryo-EM structure of the cofilactin filament core at 2.3 Angstrom resolution.
5L6W 2.53 Å, Structure Of the LIMK1-ATPgammaS-CFL1 Complex
9QFD 2.61 Å, Cryo-EM structure of the fully cofilin-1-decorated actin filament (cofilactin)
9QFQ 2.76 Å, Cryo-EM structure of the cofilactin barbed end bound by AIP1
4BEX 2.8 Å, Structure of human Cofilin1
9QFO 2.96 Å, Cryo-EM structure of the cofilactin filament pointed end
9QFE 3.12 Å, Cryo-EM structure of the actin filament hetero-decorated by Coronin-1 and Cofilin-1 on…
9QFW 3.16 Å, Cryo-EM structure of the cofilactin barbed end bound by two AIP1 molecules
6VAO 3.4 Å, Human cofilin-1 decorated actin filament
9QFG 3.49 Å, Cryo-EM structure of the actin filament hetero-decorated by Coronin-1 and Cofilin-1,…
5HVK 3.5 Å, Crystal structure of LIMK1 mutant D460N in complex with full-length cofilin-1

Browse structure collections

About this viewer

MolViewer shows 1Q8X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.