Unexpected modes of PDZ domain scaffolding revealed by structure of nnos-syntrophin complex. Determined by X-ray diffraction at 1.25 Å resolution. Released 4 May 1999.
Explore 1QAU in 3D Show helices and sheets RCSB PDB PDBe
1QAU contains 3 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 15-21 | 7 | 1 |
| β-strand | 23 | 1 | 2 |
| β-strand | 27 | 1 | 2 |
| β-strand | 30-34 | 5 | 1 |
| β-strand | 41-46 | 6 | 1 |
| α-helix | 51-55 | 5 | |
| β-strand | 63-67 | 5 | 1 |
| β-strand | 70-71 | 2 | 1 |
| α-helix | 77-86 | 10 | |
| α-helix | 88 | 1 | |
| β-strand | 92-98 | 7 | 1 |
| β-strand | 104-111 | 8 | 3 |
| β-strand | 117-124 | 8 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Neuronal nitric oxide synthase (residues 1-130) | A | protein | 112 | Rattus norvegicus | P29476 (AlphaFold model) |
>1QAU_1 NEURONAL NITRIC OXIDE SYNTHASE (RESIDUES 1-130) (chains A) NVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLV DLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQP
Unexpected modes of PDZ domain scaffolding revealed by structure of nNOS-syntrophin complex. Hillier, B.J., Christopherson, K.S., Prehoda, K.E. et al. Science (1999) 284:812-815. DOI 10.1126/science.284.5415.812 · PubMed
Other PDB entries of the same protein (UniProt P29476 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1QAU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.