1QB2: Conserved subdomain of human protein SRP54M

Crystal structure of the conserved subdomain of human protein SRP54M at 2.1A resolution: evidence for the mechanism of signal peptide binding. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Oct 1999.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,790
Mol. weight: 24.95 kDa
Released: 20 Oct 1999

Explore 1QB2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QB2 contains 13 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	329-341	13
α-helix	343-351	9
α-helix	365-379	15
α-helix	384-388	5
α-helix	393-398	6
α-helix	401-409	9
α-helix	414-430	17

Chain B: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	329-349	21
β-strand	361	1	1
β-strand	364	1	1
α-helix	366-379	14
α-helix	384-388	5
α-helix	392-398	7
α-helix	401-409	9
α-helix	414-432	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human signal recognition particle 54 kd protein	A, B	protein	109	Homo sapiens	P61011 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1QB2_1 HUMAN SIGNAL RECOGNITION PARTICLE 54 KD PROTEIN (chains A, B)
QFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQ
ELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKM

Primary citation

Crystal structure of the conserved subdomain of human protein SRP54M at 2.1 A resolution: evidence for the mechanism of signal peptide binding. Clemons Jr., W.M., Gowda, K., Black, S.D. et al. J Mol Biol (1999) 292:697-705. DOI 10.1006/jmbi.1999.3090 · PubMed

Other PDB entries of the same protein (UniProt P61011 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Y2Z 2.15 Å, NG domain of human SRP54
6Y32 2.6 Å, Structure of the GTPase heterodimer of human SRP54 and SRalpha
6Y30 2.65 Å, NG domain of human SRP54 T115A mutant
7QWQ 2.83 Å, Ternary complex of ribosome nascent chain with SRP and NAC
1MFQ 3.1 Å, Crystal Structure Analysis of a Ternary S-Domain Complex of Human Signal Recognition…
5L3Q 3.2 Å, Structure of the GTPase heterodimer of human SRP54 and SRalpha
7NFX 3.2 Å, Mammalian ribosome nascent chain complex with SRP and SRP receptor in early state A
6Y31 4.0 Å, NG domain of human SRP54 T117 deletion mutant

Browse structure collections

About this viewer

MolViewer shows 1QB2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.