1QE6: Interleukin-8 variant

Interleukin-8 with an added disulfide between residues 5 and 33 (L5C/H33C). Determined by X-ray diffraction at 2.35 Å resolution. Released 22 Mar 2000.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,510
Mol. weight: 33.72 kDa
Released: 22 Mar 2000

Explore 1QE6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QE6 contains 8 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	19-21	3
β-strand	22-28	7	1
β-strand	38-43	6	1
β-strand	48-51	4	1
α-helix	56-69	14

Chains B and D: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	19-21	3
β-strand	22-28	7	1
β-strand	31	1	2
β-strand	34	1	2
β-strand	38-43	6	1
β-strand	48-51	4	1
α-helix	56-69	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-8 variant	A, B, C, D	protein	72	Homo sapiens	P10145 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1QE6_1 INTERLEUKIN-8 VARIANT (chains A, B, C, D)
SAKECRCQCIKTYSKPFHPKFIKELRVIESGPCCANTEIIVKLSDGRELCLDPKENWVQR
VVEKFLKRAENS

Primary citation

Receptor-binding conformation of the "ELR" motif of IL-8: X-ray structure of the L5C/H33C variant at 2.35 A resolution. Gerber, N., Lowman, H., Artis, D.R. et al. Proteins (2000) 38:361-367. DOI 10.1002/(SICI)1097-0134(20000301)38:4<361::AID-PROT2>3.3.CO;2-S · PubMed

Other PDB entries of the same protein (UniProt P10145 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4XDX 0.95 Å, The crystal structure of soluble human interleukin 8 expressed in Pichia pastoris
5D14 1.0 Å, The atomic resolution crystal structure of human IL-8
6N2U 1.25 Å, IL-8 Structure from Bacterial Expression Source
3IL8 2.0 Å, Crystal structure of interleukin 8: symbiosis of NMR and crystallography
1ICW 2.01 Å, Interleukin-8, mutant with glu 38 replaced by cys and cys 50 replaced by ala
9YIP 2.2 Å, Crystal structure of human IL-8 in a large unit cell
6WZM 2.28 Å, LY3041658 Fab bound to CXCL8
8XX6 2.99 Å, Structure of CXCR2 bound to CXCL8 (CXCR2-CXCL8-Go Full map)
8XWN 3.29 Å, Structure of CXCR2 bound to CXCL8 (Ligand-receptor focused map)
6LFO 3.4 Å, Cryo-EM structure of a class A GPCR monomer
8IC0 3.41 Å, Cryo-EM structure of CXCL8 bound C-X-C chemokine receptor 1 in complex with Gi…
6LFM 3.5 Å, Cryo-EM structure of a class A GPCR

Browse structure collections

About this viewer

MolViewer shows 1QE6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.