1QFW: Gonadotropin alpha subunit

Ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit. Determined by X-ray diffraction at 3.5 Å resolution. Released 26 Apr 2000.

Method: X-ray diffraction
Resolution: 3.5 Å
Organisms: Homo sapiens, Mus musculus
Chains: 6
Atoms: 4,938
Mol. weight: 77.15 kDa
Ligands: NAG
Released: 26 Apr 2000

Explore 1QFW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QFW contains 10 α-helices and 67 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	9	1	1
β-strand	11-14	4	1
β-strand	20	1	2
β-strand	23	1	2
α-helix	24-25	2
β-strand	26-38	13	1
α-helix	39-40	2
α-helix	41-44	4
β-strand	53-57	5	1
β-strand	58-69	12	3
β-strand	75-86	12	3
β-strand	91	1	4

Chain B: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	1
β-strand	10-18	9	1
β-strand	27-41	15	1
β-strand	56-68	13	5
α-helix	72-73	2
β-strand	79-91	13	5
β-strand	93	1	4
β-strand	99	1	1

Chain H: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	11
β-strand	17-18	2	12
β-strand	21-24	4	11
α-helix	29-31	3
β-strand	35-39	5	13
β-strand	45-51	7	13
β-strand	57-59	2	13
β-strand	72-73	2	11
β-strand	78-79	2	11
β-strand	83-84	2	12
β-strand	93-97	5	13
β-strand	107	1	13
β-strand	112	1	13

Chain I: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	204-207	4	17
β-strand	218-224	7	17
α-helix	229-231	3
β-strand	234-239	6	18
β-strand	245-247	3	18
β-strand	250-251	2	18
β-strand	258-259	2	18
β-strand	268-270	3	17
β-strand	273	1	17
β-strand	278-283	6	17
α-helix	288-290	3
β-strand	292-298	7	18
β-strand	299	1	19
β-strand	309	1	19
β-strand	317-318	2	18

Chain L: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	6
β-strand	10-14	5	7
β-strand	19	1	8
β-strand	23-24	2	6
β-strand	35-42	8	9
α-helix	47-48	2
β-strand	50-52	3	9
β-strand	67-69	3	10
β-strand	74-75	2	6
β-strand	76-78	3	10
β-strand	79	1	8
β-strand	89-96	8	9
β-strand	102-104	3	9
β-strand	109-113	5	7

Chain M: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	204-207	4	14
β-strand	211-212	2	15
β-strand	219-225	7	14
β-strand	233-238	6	16
β-strand	245-248	4	16
α-helix	253	1
β-strand	254	1	16
α-helix	255	1
β-strand	262-263	2	14
β-strand	266	1	14
β-strand	270-275	6	14
β-strand	285-290	6	16
β-strand	297-298	2	16
β-strand	302-303	2	16
β-strand	304-305	2	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gonadotropin alpha subunit	A	protein	92	Homo sapiens	P01215 (AlphaFold model)
Gonadotrophin beta subunit	B	protein	145	Homo sapiens	P0DN86 (AlphaFold model)
Antibody (anti alpha subunit) (light chain)	L	protein	114	Mus musculus	P01660 (AlphaFold model)
Antibody (anti alpha subunit) (heavy chain)	H	protein	117	Mus musculus	P01750 (AlphaFold model)
Antibody (anti beta subunit) (light chain)	M	protein	108	Mus musculus	P01660 (AlphaFold model)
Antibody (anti beta subunit) (heavy chain)	I	protein	122	Mus musculus	P18526

Sequence of entity 1 (A), FASTA

>1QFW_1 GONADOTROPIN ALPHA SUBUNIT (chains A)
APDTQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Sequence of entity 2 (B), FASTA

>1QFW_2 GONADOTROPHIN BETA SUBUNIT (chains B)
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR
DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS
SKAPPPSLPSPSRLPGPSDTPILPQ

Sequence of entity 3 (L), FASTA

>1QFW_3 ANTIBODY (ANTI ALPHA SUBUNIT) (LIGHT CHAIN) (chains L)
DIELTQSPDSLAVSLGQRATISCRASESVDSYGNSFMQWYQQKPGQPPKLLIYRASNLES
GIPARFSGTGSRTDFTLTINPVEADDVATYYCQQSDEYPYMYTFGGGTKLEIKR

Sequence of entity 4 (H), FASTA

>1QFW_4 ANTIBODY (ANTI ALPHA SUBUNIT) (HEAVY CHAIN) (chains H)
QVQLQQSGAELVKPGASVKLSCKASDYTFTSYWMHWVKQRPGQGLEWIGEINPTNGRTYY
NEKFKSKATLTVAASASTAAMQASSLTSEDSAVYYCARRYGNSFDYWGQGTTVTVSS

Sequence of entity 5 (M), FASTA

>1QFW_5 ANTIBODY (ANTI BETA SUBUNIT) (LIGHT CHAIN) (chains M)
DIELTQSPKSMSMSVGERVTLSCKASETVDSFVSWYQQKPEQSPKLLIFGASNRFSGVPD
RFTGSGSATDFTLTISSVQAEDFADYHCGQTYNHPYTFGGGTKLEIKR

Sequence of entity 6 (I), FASTA

>1QFW_6 ANTIBODY (ANTI BETA SUBUNIT) (HEAVY CHAIN) (chains I)
QVQLQESGGHLVKPGGSLKLSCAASGFAFSSFDMSWIRQTPEKRLEWVASITNVGTYTYY
PGSVKGRFSISRDNARNTLNLQMSSLRSEDTALYFCARQGTAAQPYWYFDVWGAGTTVTV
SS

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Crystal structure of a ternary complex between human chorionic gonadotropin (hCG) and two Fv fragments specific for the alpha and beta-subunits. Tegoni, M., Spinelli, S., Verhoeyen, M. et al. J Mol Biol (1999) 289:1375-1385. DOI 10.1006/jmbi.1999.2845 · PubMed

Other PDB entries of the same protein (UniProt P01215 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9YXD 2.29 Å, Crystal structure of recombinant human follicle stimulating hormone in complex with an…
7UTZ 2.4 Å, Human thyrotropin analog TR1402 bound to human Thyrotropin receptor in complex with…
4AY9 2.5 Å, Structure of follicle-stimulating hormone in complex with the entire ectodomain of its…
1HCN 2.6 Å, Structure of human chorionic gonadotropin at 2.6 Å resolution from mad analysis of the…
8I2G 2.8 Å, FSHR-Follicle stimulating hormone-compound 716340-Gs complex
4MQW 2.9 Å, Structure of follicle-stimulating hormone in complex with the entire ectodomain of its…
7T9I 2.9 Å, Native human TSH bound to human Thyrotropin receptor in complex with miniGs399…
1XWD 2.92 Å, Crystal Structure of Human Follicle Stimulating Hormone Complexed with its Receptor
7XW5 2.96 Å, TSHR-thyroid stimulating hormone-Gs-ML109 complex
1FL7 3.0 Å, Human follicle stimulating hormone
1HRP 3.0 Å, Crystal structure of human chorionic gonadotropin
7FIH 3.2 Å, luteinizing hormone/choriogonadotropin receptor(S277I)-chorionic…

Browse structure collections

About this viewer

MolViewer shows 1QFW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.