1QG6: E. Coli enoyl acyl carrier protein reductase

Crystal structure of E. Coli enoyl acyl carrier protein reductase in complex with NAD and triclosan. Determined by X-ray diffraction at 1.9 Å resolution. Released 21 Sept 1999.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Escherichia coli
Chains: 4
Atoms: 8,212
Mol. weight: 114.86 kDa
Ligands: TCL, NAD
Released: 21 Sept 1999

Explore 1QG6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QG6 contains 72 α-helices and 44 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 18 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	1
α-helix	20-30	11
β-strand	34-39	6	1
α-helix	42-54	13
β-strand	60-62	3	1
α-helix	68-78	11
β-strand	85	1	2
β-strand	88-90	3	1
α-helix	97-100	4
α-helix	104-107	4
α-helix	110-117	8
α-helix	118-122	5
α-helix	123-131	9
α-helix	132-134	3
β-strand	135	1	2
α-helix	136	1
β-strand	139-145	7	1
α-helix	147-149	3
β-strand	152	1	3
α-helix	158-177	20
α-helix	178-180	3
β-strand	182-189	8	1
α-helix	196-199	4
α-helix	203-213	11
α-helix	222-233	12
α-helix	235-237	3
β-strand	244-247	4	1
α-helix	251-253	3
β-strand	254	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (enoyl-[acyl-carrier protein] reductase)	A, B, C, D	protein	261	Escherichia coli	P0AEK4 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1QG6_1 PROTEIN (ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE) (chains A, B, C, D)
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVL
QCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISS
YSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEG
VRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGIS
GEVVHVDGGFSIAAMNELELK

Ligands and cofactors

ID	Name	Formula	Copies
TCL	Triclosan	C12 H7 Cl3 O2	4
NAD	Nicotinamide-adenine-dinucleotide	C21 H27 N7 O14 P2	4

Primary citation

Kinetic and structural characteristics of the inhibition of enoyl (acyl carrier protein) reductase by triclosan. Ward, W.H., Holdgate, G.A., Rowsell, S. et al. Biochemistry (1999) 38:12514-12525. DOI 10.1021/bi9907779 · PubMed

Other PDB entries of the same protein (UniProt P0AEK4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UMW 1.54 Å, Crystal structure of E. Coli FabI in complex with NAD and Fabimycin…
7UM8 1.7 Å, Crystal structure of E. Coli FabI in complex with NAD and…
1QSG 1.75 Å, Crystal structure of enoyl reductase inhibition by triclosan
4CV2 1.8 Å, Crystal structure of E. coli FabI in complex with NADH and CG400549
3PJF 1.9 Å, Structure of ENR G93V mutant-NAD+-triclosan complex
4CV3 1.95 Å, Crystal structure of E. coli FabI in complex with NADH and PT166
5CFZ 1.97 Å, Crystal structure of E. coli FabI in apo form
1C14 2.0 Å, Crystal structure of E coli enoyl reductase-NAD+-triclosan complex
4D46 2.0 Å, Crystal structure of E. coli FabI in complex with NAD and…
5CG1 2.07 Å, Crystal structure of E. coli FabI bound to the carbamoylated benzodiazaborine inhibitor…
1DFI 2.09 Å, X-ray structure of escherichia coli enoyl reductase with bound NAD
5CG2 2.11 Å, Crystal structure of E. coli FabI bound to the thiocarbamoylated benzodiazaborine…

Browse structure collections

About this viewer

MolViewer shows 1QG6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.