Crystal structure of E. coli FabI in complex with NAD and 5-bromo-2-(4-chloro-2-hydroxyphenoxy)benzonitrile. Determined by X-ray diffraction at 2.0 Å resolution. Released 4 Mar 2015.
Explore 4D46 in 3D Show helices and sheets RCSB PDB PDBe
4D46 contains 34 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-11 | 4 | 1 |
| α-helix | 20-30 | 11 | |
| β-strand | 34-39 | 6 | 1 |
| α-helix | 42-54 | 13 | |
| β-strand | 60-62 | 3 | 1 |
| α-helix | 68-79 | 12 | |
| β-strand | 85-90 | 6 | 1 |
| α-helix | 97-100 | 4 | |
| α-helix | 104-107 | 4 | |
| α-helix | 110-117 | 8 | |
| α-helix | 118-122 | 5 | |
| α-helix | 123-131 | 9 | |
| α-helix | 132-134 | 3 | |
| β-strand | 135-145 | 11 | 1 |
| α-helix | 147-149 | 3 | |
| α-helix | 158-177 | 20 | |
| α-helix | 178-180 | 3 | |
| β-strand | 182-189 | 8 | 1 |
| α-helix | 190-191 | 2 | |
| α-helix | 222-232 | 11 | |
| α-helix | 235-237 | 3 | |
| β-strand | 244-247 | 4 | 1 |
| α-helix | 251-253 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-11 | 4 | 2 |
| α-helix | 20-30 | 11 | |
| β-strand | 34-39 | 6 | 2 |
| α-helix | 42-44 | 3 | |
| α-helix | 45-54 | 10 | |
| β-strand | 60-62 | 3 | 2 |
| α-helix | 68-79 | 12 | |
| β-strand | 85-90 | 6 | 2 |
| α-helix | 97-100 | 4 | |
| α-helix | 104-107 | 4 | |
| α-helix | 110-117 | 8 | |
| α-helix | 118-122 | 5 | |
| α-helix | 123-131 | 9 | |
| α-helix | 132-134 | 3 | |
| β-strand | 135-145 | 11 | 2 |
| α-helix | 147-149 | 3 | |
| α-helix | 158-177 | 20 | |
| α-helix | 178-180 | 3 | |
| β-strand | 182-189 | 8 | 2 |
| α-helix | 190-191 | 2 | |
| α-helix | 195-197 | 3 | |
| α-helix | 222-232 | 11 | |
| α-helix | 235-237 | 3 | |
| β-strand | 244-247 | 4 | 2 |
| α-helix | 251-253 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Enoyl-[acyl-carrier-protein] reductase [NADH] | A, B | protein | 270 | ESCHERICHIA COLI | P0AEK4 (AlphaFold model) |
>4D46_1 ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH] (chains A, B) MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI SGEVVHVDGGFSIAAMNELELKLEHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAD | Nicotinamide-adenine-dinucleotide | C21 H27 N7 O14 P2 | 2 |
| J47 | 5-bromo-2-(4-chloro-2-hydroxyphenoxy)benzonitrile | C13 H7 Br Cl N O2 | 2 |
An Ordered Water Channel in Staphylococcus Aureus Fabi: Unraveling the Mechanism of Substrate Recognition and Reduction. Schiebel, J., Chang, A., Merget, B. et al. Biochemistry (2015) 54:1943. DOI 10.1021/BI5014358 · PubMed
Other PDB entries of the same protein (UniProt P0AEK4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4D46 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.