Crystal structure of E. Coli FabI in complex with NAD and Fabimycin ((S,E)-3-(7-amino-8-oxo-6,7,8,9-tetrahydro-5H-pyrido[2,3-b]azepin-3-yl)-N-methyl-N-((3-methylbenzofuran-2-yl)methyl)acrylamide). Determined by X-ray diffraction at 1.54 Å resolution. Released 14 Dec 2022.
Explore 7UMW in 3D Show helices and sheets RCSB PDB PDBe
7UMW contains 37 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-11 | 4 | 1 |
| α-helix | 20-30 | 11 | |
| β-strand | 34-39 | 6 | 1 |
| α-helix | 42-54 | 13 | |
| β-strand | 60-62 | 3 | 1 |
| α-helix | 68-79 | 12 | |
| β-strand | 85-90 | 6 | 1 |
| α-helix | 97-100 | 4 | |
| α-helix | 104-107 | 4 | |
| α-helix | 110-117 | 8 | |
| α-helix | 118-122 | 5 | |
| α-helix | 123-131 | 9 | |
| α-helix | 132-134 | 3 | |
| β-strand | 135-145 | 11 | 1 |
| α-helix | 147-149 | 3 | |
| α-helix | 158-177 | 20 | |
| α-helix | 178-180 | 3 | |
| β-strand | 182-189 | 8 | 1 |
| α-helix | 190-191 | 2 | |
| α-helix | 195-197 | 3 | |
| α-helix | 203-213 | 11 | |
| α-helix | 222-232 | 11 | |
| α-helix | 235-237 | 3 | |
| β-strand | 244-247 | 4 | 1 |
| α-helix | 251-253 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-11 | 4 | 2 |
| α-helix | 20-30 | 11 | |
| β-strand | 34-39 | 6 | 2 |
| α-helix | 42-44 | 3 | |
| α-helix | 45-54 | 10 | |
| β-strand | 60-62 | 3 | 2 |
| α-helix | 68-79 | 12 | |
| β-strand | 85 | 1 | 3 |
| β-strand | 88-90 | 3 | 2 |
| α-helix | 97-100 | 4 | |
| α-helix | 104-107 | 4 | |
| α-helix | 110-117 | 8 | |
| α-helix | 118-122 | 5 | |
| α-helix | 123-131 | 9 | |
| α-helix | 132-134 | 3 | |
| β-strand | 135 | 1 | 3 |
| α-helix | 136 | 1 | |
| β-strand | 139-145 | 7 | 2 |
| α-helix | 147-149 | 3 | |
| α-helix | 158-177 | 20 | |
| β-strand | 182-189 | 8 | 2 |
| α-helix | 190-191 | 2 | |
| α-helix | 195-197 | 3 | |
| α-helix | 203-213 | 11 | |
| α-helix | 222-232 | 11 | |
| α-helix | 235-237 | 3 | |
| β-strand | 244-247 | 4 | 2 |
| α-helix | 251-253 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Enoyl-[acyl-carrier-protein] reductase [NADH] FabI | A, B | protein | 266 | Escherichia coli str. K-12 substr. MG1655 | P0AEK4 (AlphaFold model) |
>7UMW_1 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI (chains A, B) GDHGMGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLG SDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIA HDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANA MGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDL SAGISGEVVHVDGGFSIAAMNELELK
| ID | Name | Formula | Copies |
|---|---|---|---|
| NUC | (2E)-3-[(7S)-7-amino-8-oxo-6,7,8,9-tetrahydro-5H-pyrido[2,3-b]azepin-3-yl]-N-me… | C23 H24 N4 O3 | 2 |
| NAD | Nicotinamide-adenine-dinucleotide | C21 H27 N7 O14 P2 | 2 |
An Iterative Approach Guides Discovery of the FabI Inhibitor Fabimycin, a Late-Stage Antibiotic Candidate with In Vivo Efficacy against Drug-Resistant Gram-Negative Infections. Parker, E.N., Cain, B.N., Hajian, B. et al. ACS Cent Sci (2022) 8:1362-1362. DOI 10.1021/acscentsci.2c00969 · PubMed
Other PDB entries of the same protein (UniProt P0AEK4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7UMW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.