1QGR: Importin beta

Structure of importin beta bound to the ibb domain of importin alpha (II crystal form, grown at low PH). Determined by X-ray diffraction at 2.3 Å resolution. Released 24 May 1999.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,181
Mol. weight: 100.73 kDa
Released: 24 May 1999

Explore 1QGR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QGR contains 58 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 57 helices, 0 β-strands

Element	Residues	Length
α-helix	3-8	6
α-helix	9-11	3
α-helix	15-45	31
α-helix	51-65	15
α-helix	70-81	12
α-helix	85-98	14
α-helix	108-120	13
α-helix	121-123	3
α-helix	129-138	10
α-helix	144-160	17
α-helix	163-166	4
α-helix	167-169	3
α-helix	170-181	12
α-helix	188-201	14
α-helix	202-204	3
α-helix	206-209	4
α-helix	212-225	14
α-helix	231-247	17
α-helix	249-251	3
α-helix	253-255	3
α-helix	256-260	5
α-helix	261-268	8
α-helix	273-303	31
α-helix	314-329	16
α-helix	344-359	16
α-helix	360-363	4
α-helix	364-374	11
α-helix	380-392	13
α-helix	399-417	19
α-helix	422-438	17
α-helix	440-442	3
α-helix	449-459	11
α-helix	464-483	20
α-helix	503-513	11
α-helix	524-537	14
α-helix	544-562	19
α-helix	573-592	20
α-helix	597-601	5
α-helix	604-614	11
α-helix	623-639	17
α-helix	640-646	7
α-helix	647-660	14
α-helix	664-681	18
α-helix	682-685	4
α-helix	686-700	15
α-helix	707-709	3
α-helix	710-724	15
α-helix	725-731	7
α-helix	732-743	12
α-helix	752-777	26
α-helix	785-789	5
α-helix	791-793	3
α-helix	794-805	12
α-helix	812-829	18
α-helix	832-838	7
α-helix	841-852	12
α-helix	856-873	18

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	30-48	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (importin beta subunit)	A	protein	876	Homo sapiens	Q14974 (AlphaFold model)
Protein (importin alpha-2 subunit)	B	protein	27		P52292 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QGR_1 PROTEIN (IMPORTIN BETA SUBUNIT) (chains A)
MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAGLQ
IKNSLTSKDPDIKAQYQQRWLAIDANARREVKNYVLHTLGTETYRPSSASQCVAGIACAE
IPVNQWPELIPQLVANVTNPNSTEHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQG
MRKEEPSNNVKLAATNALLNSLEFTKANFDKESERHFIMQVVCEATQCPDTRVRVAALQN
LVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEA
AEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCE
DDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPSQLKPLVIQAMPTLIELMKDP
SVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEA
AYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSA
KDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDA
LQISDVVMASLLRMFQSTAGSGGVQEDALMAVSTLVEVLGGEFLKYMEAFKPFLGIGLKN
YAEYQVCLAAVGLVGDLCRALQSNIIPFCDEVMQLLLENLGNENVHRSVKPQILSVFGDI
ALAIGGEFKKYLEVVLNTLQQASQAQVDKSDYDMVDYLNELRESCLEAYTGIVQGLKGDQ
ENVHPDVMLVQPRVEFILSFIDHIAGDEDHTDGVVACAAGLIGDLCTAFGKDVLKLVEAR
PMIHELLTEGRRSKTNKAKTLARWATKELRKLKNQA

Sequence of entity 2 (B), FASTA

>1QGR_2 PROTEIN (IMPORTIN ALPHA-2 SUBUNIT) (chains B)
RRRRIEVNVELRKAKKDDQMLKRRNVS

Primary citation

Structure of importin-beta bound to the IBB domain of importin-alpha. Cingolani, G., Petosa, C., Weis, K. et al. Nature (1999) 399:221-229. DOI 10.1038/20367 · PubMed

Other PDB entries of the same protein (UniProt Q14974 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IBR 2.3 Å, Complex of ran with importin beta
2P8Q 2.35 Å, Crystal Structure of human Importin beta bound to the Snurportin1 IBB-domain
1QGK 2.5 Å, Structure of importin beta bound to the ibb domain of importin alpha
3W5K 2.6 Å, Crystal structure of Snail1 and importin beta complex
9N85 2.6 Å, Cryo-EM structure of human importin beta:Ran-GTP:RanBP1 trimeric complex
1F59 2.8 Å, Importin-beta-fxfg nucleoporin complex
1O6O 2.8 Å, Importin Beta aa1-442 bound to five FxFG repeats from yeast Nsp1p. Second crystal form
1O6P 2.8 Å, Importin Beta bound to a GLFG Nucleoporin peptide
2QNA 2.84 Å, Crystal structure of human Importin-beta (127-876) in complex with the IBB-domain of…
1M5N 2.9 Å, Crystal structure of HEAT repeats (1-11) of importin b bound to the non-classical…
3LWW 3.15 Å, Structure of an open and closed conformation of Human Importin Beta bound to the…
2Q5D 3.2 Å, Crystal Structure of Human Importin Beta bound to the Snurportin1 IBB-domain second…

Browse structure collections

About this viewer

MolViewer shows 1QGR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.