3W5K: Snail1 and importin beta complex

Crystal structure of Snail1 and importin beta complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 5 Mar 2014.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,588
Mol. weight: 126.64 kDa
Ligands: ZN
Released: 5 Mar 2014

Explore 3W5K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3W5K contains 62 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 57 helices, 0 β-strands

Element	Residues	Length
α-helix	19-22	4
α-helix	33-45	13
α-helix	51-65	15
α-helix	70-80	11
α-helix	85-96	12
α-helix	109-120	12
α-helix	121-123	3
α-helix	129-138	10
α-helix	144-160	17
α-helix	163-165	3
α-helix	170-181	12
α-helix	188-199	12
α-helix	206-210	5
α-helix	212-225	14
α-helix	231-247	17
α-helix	249-251	3
α-helix	253-255	3
α-helix	256-260	5
α-helix	261-268	8
α-helix	273-298	26
α-helix	306-307	2
α-helix	314-329	16
α-helix	344-359	16
α-helix	360-363	4
α-helix	364-374	11
α-helix	380-392	13
α-helix	399-416	18
α-helix	422-438	17
α-helix	440-442	3
α-helix	449-459	11
α-helix	464-482	19
α-helix	491	1
α-helix	493-494	2
α-helix	503-514	12
α-helix	521-523	3
α-helix	524-537	14
α-helix	541-543	3
α-helix	544-565	22
α-helix	571-594	24
α-helix	597-613	17
α-helix	625-639	15
α-helix	640-646	7
α-helix	647-658	12
α-helix	664-681	18
α-helix	682-685	4
α-helix	686-700	15
α-helix	709-724	16
α-helix	725-728	4
α-helix	729-743	15
α-helix	752-777	26
α-helix	785-789	5
α-helix	791-793	3
α-helix	794-805	12
α-helix	812-829	18
α-helix	831-838	8
α-helix	842-851	10
α-helix	856-874	19

Chain B: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	154	1	1
β-strand	163	1	1
α-helix	166-173	8
α-helix	174-176	3
β-strand	180-181	2	2
β-strand	188-189	2	2
α-helix	192-200	9
β-strand	208-209	2	3
β-strand	216-217	2	3
α-helix	220-227	8
β-strand	236-237	2	4
β-strand	244-245	2	4
α-helix	248-256	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit beta-1	A	protein	876	Homo sapiens	Q14974 (AlphaFold model)
Zinc finger protein SNAI1	B	protein	264	Homo sapiens	O95863 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3W5K_1 Importin subunit beta-1 (chains A)
MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAGLQ
IKNSLTSKDPDIKAQYQQRWLAIDANARREVKNYVLQTLGTETYRPSSASQCVAGIACAE
IPVNQWPELIPQLVANVTNPNSTEHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQG
MRKEEPSNNVKLAATNALLNSLEFTKANFDKESERHFIMQVVCEATQCPDTRVRVAALQN
LVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEA
AEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCE
DDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPSQLKPLVIQAMPTLIELMKDP
SVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEA
AYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSA
KDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDA
LQISDVVMASLLRMFQSTAGSGGVQEDALMAVSTLVEVLGGEFLKYMEAFKPFLGIGLKN
YAEYQVCLAAVGLVGDLCRALQSNIIPFCDEVMQLLLENLGNENVHRSVKPQILSVFGDI
ALAIGGEFKKYLEVVLNTLQQASQAQVDKSDYDMVDYLNELRESCLEAYTGIVQGLKGDQ
ENVHPDVMLVQPRVEFILSFIDHIAGDEDHTDGVVACAAGLIGDLCTAFGKDVLKLVEAR
PMIHELLTEGRRSKTNKAKTLATWATKELRKLKNQA

Sequence of entity 2 (B), FASTA

>3W5K_2 Zinc finger protein SNAI1 (chains B)
MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLI
WDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSS
LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPC
VCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQA
CARTFSRMSLLHKHQESGCSGCPR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta. Choi, S., Yamashita, E., Yasuhara, N. et al. Acta Crystallogr D Biol Crystallogr (2014) 70:1050-1060. DOI 10.1107/S1399004714000972 · PubMed

Other PDB entries of the same protein (UniProt Q14974 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IBR 2.3 Å, Complex of ran with importin beta
1QGR 2.3 Å, Structure of importin beta bound to the ibb domain of importin alpha (II crystal form,…
2P8Q 2.35 Å, Crystal Structure of human Importin beta bound to the Snurportin1 IBB-domain
1QGK 2.5 Å, Structure of importin beta bound to the ibb domain of importin alpha
9N85 2.6 Å, Cryo-EM structure of human importin beta:Ran-GTP:RanBP1 trimeric complex
1F59 2.8 Å, Importin-beta-fxfg nucleoporin complex
1O6O 2.8 Å, Importin Beta aa1-442 bound to five FxFG repeats from yeast Nsp1p. Second crystal form
1O6P 2.8 Å, Importin Beta bound to a GLFG Nucleoporin peptide
2QNA 2.84 Å, Crystal structure of human Importin-beta (127-876) in complex with the IBB-domain of…
1M5N 2.9 Å, Crystal structure of HEAT repeats (1-11) of importin b bound to the non-classical…
3LWW 3.15 Å, Structure of an open and closed conformation of Human Importin Beta bound to the…
2Q5D 3.2 Å, Crystal Structure of Human Importin Beta bound to the Snurportin1 IBB-domain second…

Browse structure collections

About this viewer

MolViewer shows 3W5K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.