1QGV: Human spliceosomal protein U5-15KD

Human spliceosomal protein U5-15KD. Determined by X-ray diffraction at 1.4 Å resolution. Released 12 Dec 1999.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,194
Mol. weight: 16.81 kDa
Released: 12 Dec 1999

Explore 1QGV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QGV contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	6	1
β-strand	7	1	1
α-helix	8	1
α-helix	11-19	9
β-strand	25-31	7	1
α-helix	36-52	17
β-strand	56-62	7	1
β-strand	80-85	6	1
β-strand	88-90	3	1
β-strand	91-93	3	2
α-helix	109-123	15
β-strand	129-131	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spliceosomal protein U5-15KD	A	protein	142	Homo sapiens	P83876 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QGV_1 SPLICEOSOMAL PROTEIN U5-15KD (chains A)
MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL
VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVY
RGARKGRGLVVSPKDYSTKYRY

Primary citation

Identification, characterization and crystal structure analysis of the human spliceosomal U5 snRNP-specific 15 kD protein. Reuter, K., Nottrott, S., Fabrizio, P. et al. J Mol Biol (1999) 294:515-525. DOI 10.1006/jmbi.1999.3258 · PubMed

Other PDB entries of the same protein (UniProt P83876 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BWQ 2.1 Å, Crystal structure of U5-15kD in a complex with PQBP1
1SYX 2.35 Å, The crystal structure of a binary U5 snRNP complex
4BWS 2.5 Å, Crystal structure of the heterotrimer of PQBP1, U5-15kD and U5-52kD.
4CDO 2.5 Å, Crystal structure of PQBP1 bound to spliceosomal U5-15kD
8H6L 2.6 Å, Cryo-EM structure of human exon-defined spliceosome in the early B state.
8H6K 2.7 Å, Cryo-EM structure of human exon-defined spliceosome in the mature B state.
6QW6 2.92 Å, Structure of the human U5.U4/U6 tri-snRNP at 2.9A resolution.
8Q7N 3.1 Å, cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)
8QOZ 3.1 Å, Cryo-EM Structure of Pre-B+5'ss+ATPgammaS Complex (core part)
8QPE 3.1 Å, Cryo-EM Structure of Pre-B-like Complex (core part)
8H6E 3.2 Å, Cryo-EM structure of human exon-defined spliceosome in the late pre-B state.
8H6J 3.25 Å, Cryo-EM structure of human exon-defined spliceosome in the mature pre-B state.

Browse structure collections

About this viewer

MolViewer shows 1QGV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.