1QQG: PH-ptb targeting region of irs-1

Crystal structure of the PH-ptb targeting region of irs-1. Determined by X-ray diffraction at 2.3 Å resolution. Released 1 Aug 1999.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,526
Mol. weight: 58.31 kDa
Released: 1 Aug 1999

Explore 1QQG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QQG contains 14 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	13-20	8	1
β-strand	27-33	7	1
β-strand	36	1	2
β-strand	40	1	2
β-strand	43-47	5	1
α-helix	50-54	5
β-strand	62-65	4	1
α-helix	66-68	3
β-strand	69-75	7	1
β-strand	83-88	6	1
β-strand	92-96	5	1
α-helix	100-113	14
β-strand	162-172	11	3
α-helix	173-176	4
β-strand	181-187	7	3
β-strand	191-196	6	3
β-strand	204-207	4	3
α-helix	208-210	3
β-strand	211-217	7	3
β-strand	220-225	6	3
β-strand	234-239	6	3
α-helix	243-258	16
α-helix	259-261	3

Chain B: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	13-20	8	4
β-strand	27-33	7	4
β-strand	36	1	5
β-strand	40	1	5
β-strand	43-47	5	4
α-helix	50-54	5
β-strand	62-65	4	4
α-helix	66-68	3
β-strand	69-75	7	4
β-strand	83-88	6	4
β-strand	92-96	5	4
α-helix	100-113	14
β-strand	162-168	7	6
α-helix	173-177	5
β-strand	181-187	7	6
β-strand	191-196	6	6
β-strand	204-207	4	6
α-helix	208-210	3
β-strand	211-217	7	6
β-strand	220-225	6	6
β-strand	234-239	6	6
α-helix	243-258	16
α-helix	259-262	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin receptor substrate 1	A, B	protein	264	Homo sapiens	P35568 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1QQG_1 INSULIN RECEPTOR SUBSTRATE 1 (chains A, B)
PPESDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAPKRS
IPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGHHDG
AAALGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLIGIY
RLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDS
VVAQNMHETILEAMRAMSDEFRPR

Primary citation

Crystal structure of the pleckstrin homology-phosphotyrosine binding (PH-PTB) targeting region of insulin receptor substrate 1. Dhe-Paganon, S., Ottinger, E.A., Nolte, R.T. et al. Proc Natl Acad Sci U S A (1999) 96:8378-8383. DOI 10.1073/pnas.96.15.8378 · PubMed

Other PDB entries of the same protein (UniProt P35568 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PPM 1.48 Å, SHP2 catalytic domain in complex with IRS1 (889-901) phosphopeptide (pSer-892, pTyr-896)
7PPL 1.53 Å, SHP2 catalytic domain in complex with IRS1 (625-639) phosphopeptide (pTyr-632, pSer-636)
5U1M 1.8 Å, Structure of the IRS-1 PTB Domain Bound to the Juxtamembrane Region of the Insulin…
1K3A 2.1 Å, Structure of the Insulin-like Growth Factor 1 Receptor Kinase
6BNT 3.2 Å, Crystal structure of AP2 mu1 adaptin C-terminal domain with IRS-1 peptide
2Z8C 3.25 Å, Phosphorylated insulin receptor tyrosine kinase in complex with…
1IRS Irs-1 ptb domain complexed with a il-4 receptor phosphopeptide, NMR, minimized average…

Browse structure collections

About this viewer

MolViewer shows 1QQG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.