1K3A: Insulin-like Growth Factor 1 Receptor Kinase

Structure of the Insulin-like Growth Factor 1 Receptor Kinase. Determined by X-ray diffraction at 2.1 Å resolution. Released 28 Nov 2001.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,548
Mol. weight: 36.51 kDa
Ligands: ACP
Released: 28 Nov 2001

Explore 1K3A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1K3A contains 17 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	963	1	1
α-helix	966-968	3
β-strand	969-977	9	1
β-strand	982-992	11	1
β-strand	995-1005	11	1
α-helix	1011-1024	14
β-strand	1032	1	2
α-helix	1033-1034	2
β-strand	1035-1039	5	1
β-strand	1045-1050	6	1
β-strand	1056	1	2
α-helix	1057-1062	6
α-helix	1079-1098	20
β-strand	1101-1102	2	3
α-helix	1108-1110	3
β-strand	1111-1113	3	2
β-strand	1119-1121	3	2
β-strand	1128-1129	2	3
β-strand	1136-1137	2	4
β-strand	1141-1144	4	5
α-helix	1146-1148	3
α-helix	1151-1156	6
β-strand	1158-1159	2	4
α-helix	1161-1176	16
α-helix	1180-1181	2
α-helix	1188-1196	9
α-helix	1209-1218	10
α-helix	1223-1225	3
α-helix	1227-1228	2
α-helix	1229-1236	8
α-helix	1237-1239	3
α-helix	1244-1247	4

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	9-12	4	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
insulin-like growth factor 1 receptor	A	protein	299	Homo sapiens	P08069 (AlphaFold model)
insulin receptor substrate 1	B	protein	14		P35568 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1K3A_1 insulin-like growth factor 1 receptor (chains A)
VPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEF
LNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPP
SLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYR
KGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVME
GGLLDKPDNCPDMLLELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK

Sequence of entity 2 (B), FASTA

>1K3A_2 insulin receptor substrate 1 (chains B)
KKKSPGEYVNIEFG

Ligands and cofactors

ID	Name	Formula	Copies
ACP	Phosphomethylphosphonic acid adenylate ester	C11 H18 N5 O12 P3	1

Primary citation

Structure and autoregulation of the insulin-like growth factor 1 receptor kinase. Favelyukis, S., Till, J.H., Hubbard, S.R. et al. Nat Struct Biol (2001) 8:1058-1063. DOI 10.1038/nsb721 · PubMed

Other PDB entries of the same protein (UniProt P08069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1P4O 1.5 Å, Structure of Apo unactivated IGF-1R KInase domain at 1.5A resolution.
8PYN 1.71 Å, Human IGF1R with inhibitor 56
3LW0 1.79 Å, IGF-1RK in complex with ligand MSC1609119A-1
5FXS 1.9 Å, IGFR-1R complex with a pyrimidine inhibitor.
2OJ9 2.0 Å, Structure of IGF-1R kinase domain complexed with a benzimidazole inhibitor
3I81 2.08 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with…
1JQH 2.1 Å, IGF-1 receptor kinase domain
3O23 2.1 Å, Human unphosphorylated IGF1-R Kinase domain in complex with an hydantoin inhibitor
4D2R 2.1 Å, Human IGF in complex with a Dyrk1B inhibitor
3NW7 2.11 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…
3NW5 2.14 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…
3NW6 2.2 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…

Browse structure collections

About this viewer

MolViewer shows 1K3A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.