1RBP: Plasma retinol-binding protein precursor

Crystallographic refinement of human serum retinol binding protein at 2 Å resolution. Determined by X-ray diffraction at 2.0 Å resolution. Released 15 Jul 1991.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,582
Mol. weight: 21.27 kDa
Ligands: RTL
Released: 15 Jul 1991

Explore 1RBP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RBP contains 2 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	22-30	9	1
β-strand	39-47	9	1
β-strand	53-63	11	1
β-strand	67-79	13	1
β-strand	85-92	8	1
β-strand	100-109	10	1
β-strand	114-123	10	1
β-strand	129-138	10	1
α-helix	146-158	13
β-strand	166-167	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plasma retinol-binding protein precursor	A	protein	182	Homo sapiens	P02753 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1RBP_1 PLASMA RETINOL-BINDING PROTEIN PRECURSOR (chains A)
ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGR
VRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSC
RLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSER
NL

Ligands and cofactors

ID	Name	Formula	Copies
RTL	Retinol	C20 H30 O	1

Primary citation

Crystallographic refinement of human serum retinol binding protein at 2A resolution. Cowan, S.W., Newcomer, M.E., Jones, T.A. Proteins (1990) 8:44-61. DOI 10.1002/prot.340080108 · PubMed

Other PDB entries of the same protein (UniProt P02753 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NU2 1.5 Å, Structure of non-fluorescent human urine RBP4
5NU7 1.5 Å, Structure of human holo plasma RBP4
5NU9 1.5 Å, Structure of human amniotic fluid RBP4 saturated with palmitate
5NU8 1.59 Å, Structure of human urine RBP4 saturated with palmitate
5NUA 1.6 Å, Structure of human urine RBP4 saturated with laurate
5NUB 1.6 Å, Structure of human amniotic fluid RBP4 saturated with laurate
2WQ9 1.65 Å, Crystal Structure of RBP4 bound to Oleic Acid
5NU6 1.68 Å, Structure of non-fluorescent human amniotic fluid RBP4
1JYD 1.7 Å, Crystal Structure of Recombinant Human Serum Retinol-Binding Protein at 1.7 A Resolution
2WR6 1.8 Å, Structure of the complex of RBP4 with linoleic acid
6QBA 1.8 Å, Crystal Structure of Retinol-Binding Protein 4 (RBP4) in complex with non-retinoid…
1JYJ 2.0 Å, Crystal Structure of a Double Variant (W67L/W91H) of Recombinant Human Serum…

Browse structure collections

About this viewer

MolViewer shows 1RBP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.