HIS92ALA mutation in ribonuclease T1 induces segmental flexibility. An X-ray study. Determined by X-ray diffraction at 1.8 Å resolution. Released 15 Jan 1993.
Explore 1RN4 in 3D Show helices and sheets RCSB PDB PDBe
1RN4 contains 4 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-6 | 3 | 1 |
| β-strand | 9-11 | 3 | 1 |
| α-helix | 13-29 | 17 | |
| β-strand | 33 | 1 | 2 |
| β-strand | 38 | 1 | 2 |
| β-strand | 40-42 | 3 | 3 |
| α-helix | 53 | 1 | |
| α-helix | 55 | 1 | |
| β-strand | 56-61 | 6 | 3 |
| α-helix | 66-68 | 3 | |
| β-strand | 76-81 | 6 | 3 |
| β-strand | 86-92 | 7 | 3 |
| β-strand | 100-102 | 3 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ribonuclease T1 | A | protein | 104 | Aspergillus oryzae | P00651 (AlphaFold model) |
>1RN4_1 RIBONUCLEASE T1 (chains A) ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWP ILSSGDVYSGGSPGADRVVFNENNQLAGVITATGASGNNFVECT
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 1 |
His92Ala mutation in ribonuclease T1 induces segmental flexibility. An X-ray study. Koellner, G., Choe, H.W., Heinemann, U. et al. J Mol Biol (1992) 224:701-713. DOI 10.1016/0022-2836(92)90554-W · PubMed
Other PDB entries of the same protein (UniProt P00651 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1RN4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.