1RNB: Barnase-d(gpc) complex

Crystal structure of a barnase-d(*gp*c) complex at 1.9 Å resolution. Determined by X-ray diffraction at 1.9 Å resolution. Released 15 Jul 1992.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Bacillus amyloliquefaciens
Chains: 2
Atoms: 1,008
Mol. weight: 13.07 kDa
Released: 15 Jul 1992

Explore 1RNB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RNB contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-17	11
β-strand	24-25	2	1
α-helix	27-32	6
α-helix	37-39	3
α-helix	42-45	4
β-strand	50-51	2	1
β-strand	52-56	5	2
β-strand	71-75	5	2
β-strand	87-91	5	2
β-strand	96-99	4	2
β-strand	107-108	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(gpc)-3')	C	DNA	2
Barnase	A	protein	110	Bacillus amyloliquefaciens	P00648 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>1RNB_1 DNA (5'-D(*GP*C)-3') (chains C)
GC

Sequence of entity 2 (A), FASTA

>1RNB_2 BARNASE (chains A)
AQVINTFDGVADYLQTYHKLPNDYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNRE
GKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR

Primary citation

Crystal structure of a barnase-d(GpC) complex at 1.9 A resolution. Baudet, S., Janin, J. J Mol Biol (1991) 219:123-132. DOI 10.1016/0022-2836(91)90862-Z · PubMed

Other PDB entries of the same protein (UniProt P00648 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PQK 1.2 Å, Cryogenic crystal structure of barnase A43C/S80C bound to barstar C40A/S59C/A67C/C82A
2C4B 1.3 Å, Inhibitor cystine knot protein McoEeTI fused to the catalytically inactive barnase…
1A2P 1.5 Å, Barnase wildtype structure at 1.5 Å resolution
2ZA4 1.58 Å, Crystal Structural Analysis of Barnase-barstar Complex
1B20 1.7 Å, Deletion of a buried salt-bridge in barnase
1BRN 1.76 Å, Subsite binding in an RNase: structure of a barnase-tetranucleotide complex at 1.76 Å…
1B2X 1.8 Å, Barnase wildtype structure at PH 7.5 from a cryo_cooled crystal at 100K
1B2S 1.82 Å, Structural response to mutation at a protein-protein interface
1BRI 1.9 Å, Barnase mutant with ile 76 replaced by ala
1X1Y 1.9 Å, Water-mediate interaction at aprotein-protein interface
3KCH 1.94 Å, Baranase crosslinked by glutaraldehyde
2F5M 1.95 Å, Cross-linked barnase soaked in bromo-ethanol

Browse structure collections

About this viewer

MolViewer shows 1RNB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.

1RNB: Barnase-d(*gp*c) complex