Structural Mechanisms of Camptothecin Resistance by Mutations in Human Topoisomerase I. Determined by X-ray diffraction at 2.3 Å resolution. Released 6 Jul 2004.
Explore 1RRJ in 3D Show helices and sheets RCSB PDB PDBe
1RRJ contains 34 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 205-207 | 3 | |
| α-helix | 209-212 | 4 | |
| β-strand | 220-221 | 2 | 1 |
| α-helix | 225 | 1 | |
| β-strand | 226 | 1 | 2 |
| α-helix | 227-231 | 5 | |
| β-strand | 241-242 | 2 | 3 |
| β-strand | 245-246 | 2 | 3 |
| α-helix | 248-250 | 3 | |
| α-helix | 251-261 | 11 | |
| α-helix | 267-270 | 4 | |
| α-helix | 272-285 | 14 | |
| α-helix | 288-291 | 4 | |
| β-strand | 300-301 | 2 | 3 |
| α-helix | 303-316 | 14 | |
| α-helix | 321-338 | 18 | |
| β-strand | 340-343 | 4 | 1 |
| β-strand | 346-349 | 4 | 1 |
| β-strand | 350 | 1 | 4 |
| β-strand | 354 | 1 | 2 |
| α-helix | 355-358 | 4 | |
| β-strand | 359-360 | 2 | 5 |
| β-strand | 373-374 | 2 | 5 |
| α-helix | 375-378 | 4 | |
| α-helix | 379-381 | 3 | |
| β-strand | 383-385 | 3 | 6 |
| α-helix | 392-395 | 4 | |
| β-strand | 403-405 | 3 | 6 |
| β-strand | 414-417 | 4 | 6 |
| α-helix | 423 | 1 | |
| β-strand | 424-427 | 4 | 6 |
| β-strand | 429 | 1 | 4 |
| α-helix | 434-451 | 18 | |
| α-helix | 454-463 | 10 | |
| α-helix | 464-466 | 3 | |
| α-helix | 470-484 | 15 | |
| β-strand | 508 | 1 | 7 |
| α-helix | 509-511 | 3 | |
| β-strand | 512-518 | 7 | 8 |
| β-strand | 521-530 | 10 | 8 |
| α-helix | 532-534 | 3 | |
| β-strand | 536-542 | 7 | 8 |
| α-helix | 545-554 | 10 | |
| β-strand | 563 | 1 | 7 |
| α-helix | 570-580 | 11 | |
| α-helix | 587-605 | 19 | |
| α-helix | 612-629 | 18 | |
| β-strand | 633 | 1 | 9 |
| α-helix | 640-642 | 3 | |
| α-helix | 643-670 | 28 | |
| α-helix | 681-710 | 30 | |
| β-strand | 714 | 1 | 9 |
| α-helix | 717-721 | 5 | |
| α-helix | 726-736 | 11 | |
| α-helix | 740-742 | 3 | |
| α-helix | 746-751 | 6 | |
| α-helix | 753-757 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 5'-d(*ap*ap*ap*ap*ap*gp*ap*cp*tp*t*gp*gp*ap*ap*ap*ap*ap*tp*tp*tp*tp*t)-3' | B | DNA | 22 | ||
| 5'-d(*ap*ap*ap*ap*ap*tp*tp*tp*tp*tp*cp*cp*ap*ap*gp*tp*cp*tp*tp*tp*tp*t)-3' | C | DNA | 22 | ||
| DNA topoisomerase I | A | protein | 565 | Homo sapiens | P11387 (AlphaFold model) |
>1RRJ_1 5'-D(*AP*AP*AP*AP*AP*GP*AP*CP*TP*T*GP*GP*AP*AP*AP*AP*AP*TP*TP*TP*TP*T)-3' (chains B) AAAAAGACTTGGAAAAATTTTT
>1RRJ_2 5'-D(*AP*AP*AP*AP*AP*TP*TP*TP*TP*TP*CP*CP*AP*AP*GP*TP*CP*TP*TP*TP*TP*T)-3' (chains C) AAAAATTTTTCCAAGTCTTTTT
>1RRJ_3 DNA topoisomerase I (chains A) QKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFF AKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMS KEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPE DIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKD WQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETAD TVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQP EDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYN RANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKT KKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLSYLDPRITVAWCKKWGVPI EKIYNKTQREKFAWAIDMADEDYEF
| ID | Name | Formula | Copies |
|---|---|---|---|
| TTG | 2-(1-dimethylaminomethyl-2-hydroxy-8-hydroxymethyl-9-oxo-9,11-dihydro-indolizin… | C23 H25 N3 O6 | 1 |
| TTC | (s)-10-[(dimethylamino)methyl]-4-ethyl-4,9-dihydroxy-1H-PYRANO[3',4':6,7]INOLIZ… | C23 H23 N3 O5 | 1 |
Mechanisms of camptothecin resistance by human topoisomerase I mutations. Chrencik, J.E., Staker, B.L., Burgin, A.B. et al. J Mol Biol (2004) 339:773-784. DOI 10.1016/j.jmb.2004.03.077 · PubMed
Other PDB entries of the same protein (UniProt P11387 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1RRJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.