Human DNA topoisomerase I (70 kDa) in complex with the indenoisoquinoline AI-III-52 and covalent complex with a 22 base pair DNA duplex. Determined by X-ray diffraction at 3.1 Å resolution. Released 21 Jun 2005.
Explore 1TL8 in 3D Show helices and sheets RCSB PDB PDBe
1TL8 contains 29 α-helices and 25 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 220-221 | 2 | 1 |
| α-helix | 225 | 1 | |
| β-strand | 226 | 1 | 2 |
| α-helix | 227-231 | 5 | |
| α-helix | 233-235 | 3 | |
| β-strand | 240-242 | 3 | 3 |
| β-strand | 245-247 | 3 | 3 |
| α-helix | 251-263 | 13 | |
| α-helix | 267-270 | 4 | |
| α-helix | 272-284 | 13 | |
| α-helix | 288-293 | 6 | |
| β-strand | 300-301 | 2 | 3 |
| α-helix | 303-314 | 12 | |
| α-helix | 321-337 | 17 | |
| β-strand | 340-343 | 4 | 1 |
| β-strand | 347-349 | 3 | 1 |
| β-strand | 350 | 1 | 4 |
| β-strand | 354 | 1 | 2 |
| α-helix | 355-358 | 4 | |
| β-strand | 360 | 1 | 5 |
| β-strand | 373 | 1 | 5 |
| α-helix | 379-381 | 3 | |
| β-strand | 382-385 | 4 | 6 |
| α-helix | 392-396 | 5 | |
| β-strand | 403-405 | 3 | 6 |
| β-strand | 414-417 | 4 | 6 |
| β-strand | 424-427 | 4 | 6 |
| β-strand | 429 | 1 | 4 |
| α-helix | 434-452 | 19 | |
| α-helix | 454-463 | 10 | |
| α-helix | 470-485 | 16 | |
| β-strand | 495 | 1 | 7 |
| β-strand | 498 | 1 | 7 |
| β-strand | 508 | 1 | 8 |
| α-helix | 509-511 | 3 | |
| β-strand | 512-518 | 7 | 9 |
| β-strand | 521-527 | 7 | 9 |
| β-strand | 530 | 1 | 10 |
| α-helix | 532-534 | 3 | |
| β-strand | 536 | 1 | 10 |
| β-strand | 539-542 | 4 | 9 |
| α-helix | 545-555 | 11 | |
| β-strand | 563 | 1 | 8 |
| α-helix | 570-580 | 11 | |
| α-helix | 588-603 | 16 | |
| α-helix | 612-629 | 18 | |
| α-helix | 651-663 | 13 | |
| α-helix | 665-668 | 4 | |
| α-helix | 689-709 | 21 | |
| α-helix | 717-721 | 5 | |
| α-helix | 726-735 | 10 | |
| α-helix | 740-742 | 3 | |
| α-helix | 746-751 | 6 | |
| α-helix | 753-758 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 5'-d(*ap*ap*ap*ap*ap*gp*ap*cp*tp*t)-3' | B | DNA | 10 | ||
| 5'-d(*(tpc)p*gp*ap*ap*ap*ap*ap*tp*tp*tp*tp*t)-3' | C | DNA | 12 | ||
| 5'-d(*ap*ap*ap*ap*ap*tp*tp*tp*tp*tp*cp*gp*ap*ap*gp*tp*cp*tp*tp*tp*tp*t)-3' | D | DNA | 22 | ||
| DNA topoisomerase I | A | protein | 592 | Homo sapiens | P11387 (AlphaFold model) |
>1TL8_1 5'-D(*AP*AP*AP*AP*AP*GP*AP*CP*TP*T)-3' (chains B) AAAAAGACTT
>1TL8_2 5'-D(*(TPC)P*GP*AP*AP*AP*AP*AP*TP*TP*TP*TP*T)-3' (chains C) CGAAAAATTTTT
>1TL8_3 5'-D(*AP*AP*AP*AP*AP*TP*TP*TP*TP*TP*CP*GP*AP*AP*GP*TP*CP*TP*TP*TP*TP*T)-3' (chains D) AAAAATTTTTCGAAGTCTTTTT
>1TL8_4 DNA topoisomerase I (chains A) KKPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEP LPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNI ITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANF KIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWL VSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVR QRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKD SIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYN ASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDA KKEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQ IALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
| ID | Name | Formula | Copies |
|---|---|---|---|
| AI3 | 2,3-dimethoxy-12H-[1,3]DIOXOLO[5,6]INDENO[1,2-c]isoquinolin-6-ium | C19 H16 N O4 | 1 |
Synthesis and Mechanism of Action Studies of a Series of Norindenoisoquinoline Topoisomerase I Poisons Reveal an Inhibitor with a Flipped Orientation in the Ternary DNA-Enzyme-Inhibitor Complex As Determined by X-ray Crystallographic Analysis. Ioanoviciu, A., Antony, S., Pommier, Y. et al. J Med Chem (2005) 48:4803-4814. DOI 10.1021/jm050076b · PubMed
Other PDB entries of the same protein (UniProt P11387 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1TL8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.