1RTG: Human gelatinase a

C-terminal domain (haemopexin-like domain) of human matrix metalloproteinase-2. Determined by X-ray diffraction at 2.6 Å resolution. Released 10 Jun 1996.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,721
Mol. weight: 23.94 kDa
Ligands: CA
Released: 10 Jun 1996

Explore 1RTG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RTG contains 8 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	463-466	4
β-strand	477-481	5	1
β-strand	484-489	6	1
β-strand	492-496	5	1
β-strand	504-508	5	1
α-helix	509-512	4
β-strand	522-526	5	2
β-strand	531-536	6	2
β-strand	539-543	5	2
β-strand	548	1	2
α-helix	549	1
β-strand	554-555	2	2
α-helix	556-559	4
β-strand	570-574	5	3
β-strand	579-584	6	3
β-strand	587-592	6	3
β-strand	597-598	2	3
α-helix	599	1
β-strand	604-605	2	3
α-helix	606-609	4
α-helix	613-614	2
β-strand	619-622	4	4
β-strand	628-633	6	4
β-strand	636-641	6	4
β-strand	647-652	6	4
α-helix	653-656	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human gelatinase a	A	protein	210	Homo sapiens	P08253 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1RTG_1 HUMAN GELATINASE A (chains A)
IDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVA
TFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDA
AFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSY
FFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Water and common crystallization additives (CL) are not listed.

Primary citation

The C-terminal (haemopexin-like) domain structure of human gelatinase A (MMP2): structural implications for its function. Gohlke, U., Gomis-Ruth, F.X., Crabbe, T. et al. FEBS Lett (1996) 378:126-130. DOI 10.1016/0014-5793(95)01435-7 · PubMed

Other PDB entries of the same protein (UniProt P08253 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AYU 2.0 Å, Crystal structure of MMP-2 active site mutant in complex with APP-drived decapeptide…
7XJO 2.0 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1GEN 2.15 Å, C-terminal domain of gelatinase a
8H78 2.4 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1EAK 2.66 Å, Catalytic domain of proMMP-2 E404Q mutant
1CK7 2.8 Å, Gelatinase a (full-length)
1QIB 2.8 Å, Crystal structure of gelatinase a catalytic domain
7XGJ 2.8 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1GXD 3.1 Å, proMMP-2/TIMP-2 complex
1CXW The second type II module from human matrix metalloproteinase 2
1HOV Solution structure of a catalytic domain of mmp-2 complexed with sc-74020
1J7M The Third Fibronectin Type II Module from Human Matrix Metalloproteinase 2

Browse structure collections

About this viewer

MolViewer shows 1RTG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.