1RYH: PDB entry 1RYH

Alternative Splicing of Rac1 Generates Rac1b, a Self-activating GTPase. Determined by X-ray diffraction at 1.75 Å resolution. Released 27 Jan 2004.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,940
Mol. weight: 45.83 kDa
Ligands: GNP, MG
Released: 27 Jan 2004

Explore 1RYH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RYH contains 19 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2A-10	11	1
α-helix	16-25	10
β-strand	39-46	8	1
β-strand	49-56	8	1
β-strand	96-102	7	1
α-helix	106-111	6
α-helix	112-116	5
α-helix	117-123	7
β-strand	129-134	6	1
α-helix	136-139	4
α-helix	142-149	8
α-helix	155-157	3
α-helix	158-168	11
β-strand	172-175	4	1
α-helix	184-196	13
α-helix	198-200	3

Chain B: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2A-10	11	1
α-helix	16-25	10
β-strand	39-46	8	1
β-strand	49-56	8	1
β-strand	96-102	7	1
α-helix	106-111	6
α-helix	112-116	5
α-helix	117-123	7
β-strand	129-134	6	1
α-helix	136-139	4
α-helix	142-150	9
α-helix	155-157	3
α-helix	158-168	11
β-strand	172-175	4	1
α-helix	184-196	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ras-related C3 botulinum toxin substrate 1 isoform Rac1b	A, B	protein	203	Homo sapiens	P63000 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1RYH_1 ras-related C3 botulinum toxin substrate 1 isoform Rac1b (chains A, B)
GSMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDT
AGQEDYDRLRPLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAKWYP
EVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSA
LTQRGLKTVFDEAIRAVLCPPPV

Ligands and cofactors

ID	Name	Formula	Copies
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	2
MG	Magnesium ion	Mg	2

Primary citation

Alternative Splicing of Rac1 Generates Rac1b, a Self-activating GTPase. Fiegen, D., Haeusler, L.C., Blumenstein, L. et al. J Biol Chem (2004) 279:4743-4749. DOI 10.1074/jbc.M310281200 · PubMed

Other PDB entries of the same protein (UniProt P63000 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RFF 1.25 Å, Crystal Structure of Human Rac1 Fused with the Scaffold Protein POSH (residues 319-371)
9IFK 1.34 Å, Crystal structure of Kalirin/Rac1 in complex with DK-2
1MH1 1.38 Å, Small G-protein
9HU8 1.48 Å, Crystal structure of Kalirin/Rac1 in complex with MC-278.
2WKQ 1.6 Å, Structure of a photoactivatable Rac1 containing the Lov2 C450A Mutant
6X1G 1.6 Å, Crystal structure of a GEF domain from the Orientia tsutsugamushi protein OtDUB in…
5O33 1.64 Å, A structure of the GEF Kalirin DH1 domain in complex with the small GTPase Rac1
9IG1 1.65 Å, Crystal structure of Kalirin/Rac1 in complex with DK-652
9I1L 1.68 Å, Crystal structure of Kalirin/Rac1 in complex with RS-009
8I5V 1.73 Å, DOCK10 mutant L1903Y complexed with Rac1
1RYF 1.75 Å, Alternative Splicing of Rac1 Generates Rac1b, a Self-activating GTPase
9TJY 1.77 Å, Crystal Structure of the Human Oncogenic Splice Variant Rac1b Fused with the Scaffold…

Browse structure collections

About this viewer

MolViewer shows 1RYH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.