1RZ4: Human eIF3k

Crystal Structure of Human eIF3k. Determined by X-ray diffraction at 2.1 Å resolution. Released 21 Sept 2004.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,867
Mol. weight: 26.53 kDa
Released: 21 Sept 2004

Explore 1RZ4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RZ4 contains 17 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	3-16	14
α-helix	18-21	4
α-helix	23-25	3
α-helix	26-39	14
α-helix	44-56	13
α-helix	58-60	3
α-helix	63-75	13
α-helix	81-87	7
α-helix	91-94	4
α-helix	99-110	12
α-helix	114-120	7
α-helix	126-129	4
α-helix	134-149	16
β-strand	152-153	2	1
α-helix	155-161	7
α-helix	167-177	11
β-strand	180-181	2	1
β-strand	187-188	2	1
α-helix	192-195	4
α-helix	207-214	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 3 subunit 11	A	protein	226	Homo sapiens	Q9UBQ5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1RZ4_1 Eukaryotic translation initiation factor 3 subunit 11 (chains A)
MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAF
FQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQA
LDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWS
ADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQLEHHHHHH

Primary citation

Crystal structure of human eIF3k, the first structure of eIF3 subunits. Wei, Z., Zhang, P., Zhou, Z. et al. J Biol Chem (2004) 279:34983-34990. DOI 10.1074/jbc.M405158200 · PubMed

Other PDB entries of the same protein (UniProt Q9UBQ5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PPL 2.65 Å, MERS-CoV Nsp1 bound to the human 43S pre-initiation complex
28ZX 2.8 Å, human 48S PIC with mRNA (Kozak_1)
6ZP4 2.9 Å, SARS-CoV-2 Nsp1 bound to a human 43S preinitiation ribosome complex - state 2
8PJ5 2.9 Å, Structure of human 48S translation initiation complex after eIF2 release prior 60S…
8PJ6 2.9 Å, Structure of human 48S translation initiation complex with initiator tRNA, eIF1A and…
28ZY 3.0 Å, human 48S PIC with mRNA (Kozak_2)
6ZON 3.0 Å, SARS-CoV-2 Nsp1 bound to a human 43S preinitiation ribosome complex - state 1
9KZU 3.0 Å, Cryo-EM structure of the HCV IRES-dependently initiated CMV-stalled 80S ribosome…
8PJ4 3.2 Å, Structure of human 48S translation initiation complex after eIF5 release (48S-4)
9KN5 3.2 Å, Structure of the human 40S ribosome complexed with HCV IRES, eIF1A and eIF3
9KRP 3.2 Å, Structure of the HCV IRES-dependent 48S translation initiation complex with eIF5B and eIF3
6YBD 3.3 Å, Structure of a human 48S translational initiation complex - eIF3

Browse structure collections

About this viewer

MolViewer shows 1RZ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.