1S3X: Human Hsp70 ATPase domain

Name: PDB 1S3X: The crystal structure of the human Hsp70 ATPase domain
Published: 2004-01-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

The crystal structure of the human Hsp70 ATPase domain. Determined by X-ray diffraction at 1.84 Å resolution. Released 20 Jan 2004.

Method: X-ray diffraction
Resolution: 1.84 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,375
Mol. weight: 42.75 kDa
Ligands: ADP, CA, PO4
Released: 20 Jan 2004

Explore 1S3X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1S3X contains 17 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
β-strand	7-11	5	1
β-strand	15-22	8	1
β-strand	25-28	4	1
α-helix	29-30	2
β-strand	38-39	2	1
β-strand	42-44	3	2
β-strand	49-51	3	2
α-helix	53-57	5
α-helix	63-65	3
β-strand	66-67	2	2
α-helix	70-72	3
α-helix	81-87	7
β-strand	93-96	4	3
β-strand	101-107	7	3
β-strand	110-114	5	3
α-helix	116-135	20
β-strand	141-146	6	1
α-helix	152-164	13
β-strand	168-174	7	1
α-helix	175-182	8
β-strand	192-200	9	4
β-strand	205-213	9	4
β-strand	216-225	10	4
α-helix	230-249	20
α-helix	257-273	17
β-strand	279-288	10	5
β-strand	291-298	8	5
α-helix	299-312	14
α-helix	314-323	10
α-helix	328-330	3
β-strand	333-337	5	4
α-helix	339-342	4
α-helix	344-353	10
β-strand	360	1	4
α-helix	368-381	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock 70 kDa protein 1	A	protein	382	Homo sapiens	P0DMV8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1S3X_1 Heat shock 70 kDa protein 1 (chains A)
MAKAAAIGIDLGTTYSCIGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMG

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
CA	Calcium ion	Ca	2
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Human Hsp70 molecular chaperone binds two calcium ions within the ATPase domain. SRIRAM, M., OSIPIUK, J., FREEMAN, B. et al. Structure (1997) 5:403-414. DOI 10.1016/S0969-2126(97)00197-4 · PubMed

Other PDB entries of the same protein (UniProt P0DMV8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BN8 1.34 Å, Crystal structure of nucleotide-free human Hsp70 NBD.
6K39 1.4 Å, Structural analysis of AIMP2-DX2 and HSP70 interaction
6G3R 1.4 Å, Structure of tellurium-centred Anderson-Evans polyoxotungstate (TEW) bound to the…
6ZYI 1.52 Å, Crystal structure of HSP70 ATPase domain in complex with ADP and calcium
5AQW 1.53 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
3Q49 1.54 Å, Crystal structure of the TPR domain of CHIP complexed with Hsp70-C peptide
5AQY 1.56 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
3ATV 1.58 Å, Crystal structure of human Hsp70 NBD in the ADP-bound and Mg ion-free state
3ATU 1.65 Å, Crystal structure of human Hsp70 NBD in the ADP- and Mg ion-bound state
5AQZ 1.65 Å, HSP72 with adenosine-derived inhibitor
6FHK 1.66 Å, Structure of a modified protein containing a genetically encoded phosphoserine
5BN9 1.69 Å, Crystal structure of ADP bound human Hsp70 NBD mutant R272K.

Browse structure collections

About this viewer

MolViewer shows 1S3X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.