5BN9: ADP bound human Hsp70 NBD mutant R272K

Crystal structure of ADP bound human Hsp70 NBD mutant R272K. Determined by X-ray diffraction at 1.69 Å resolution. Released 14 Sept 2016.

Method: X-ray diffraction
Resolution: 1.69 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,268
Mol. weight: 43.55 kDa
Ligands: PO4, ADP
Released: 14 Sept 2016

Explore 5BN9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5BN9 contains 18 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
β-strand	15-16	2	2
β-strand	17-22	6	1
β-strand	25-28	4	1
α-helix	29-30	2
β-strand	38-39	2	2
β-strand	42-44	3	3
β-strand	49-51	3	3
α-helix	53-56	4
α-helix	63-65	3
β-strand	66-67	2	3
α-helix	70-73	4
α-helix	81-87	7
β-strand	93-97	5	4
β-strand	100-107	8	4
β-strand	110-114	5	4
α-helix	116-135	20
β-strand	141-146	6	1
α-helix	152-164	13
β-strand	168-174	7	1
α-helix	175-182	8
α-helix	185-187	3
β-strand	193-200	8	5
β-strand	205-213	9	5
β-strand	216-225	10	5
α-helix	230-249	20
α-helix	257-273	17
β-strand	279-288	10	6
β-strand	291-298	8	6
α-helix	299-305	7
α-helix	307-311	5
α-helix	314-324	11
α-helix	328-330	3
β-strand	333-337	5	5
α-helix	339-342	4
α-helix	344-353	10
β-strand	360	1	5
α-helix	368-381	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock 70 kDa protein 1A	A	protein	388	Homo sapiens	P0DMV8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5BN9_1 Heat shock 70 kDa protein 1A (chains A)
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKKTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENV

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Water and common crystallization additives (NA, CL, EPE) are not listed.

Primary citation

Nucleotide binding to variants of the HSP70-NBD. Narayanan, D., Pflug, A., Christopeit, T. et al. To be published.

Other PDB entries of the same protein (UniProt P0DMV8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BN8 1.34 Å, Crystal structure of nucleotide-free human Hsp70 NBD.
6K39 1.4 Å, Structural analysis of AIMP2-DX2 and HSP70 interaction
6G3R 1.4 Å, Structure of tellurium-centred Anderson-Evans polyoxotungstate (TEW) bound to the…
6ZYI 1.52 Å, Crystal structure of HSP70 ATPase domain in complex with ADP and calcium
5AQW 1.53 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
3Q49 1.54 Å, Crystal structure of the TPR domain of CHIP complexed with Hsp70-C peptide
5AQY 1.56 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
3ATV 1.58 Å, Crystal structure of human Hsp70 NBD in the ADP-bound and Mg ion-free state
3ATU 1.65 Å, Crystal structure of human Hsp70 NBD in the ADP- and Mg ion-bound state
5AQZ 1.65 Å, HSP72 with adenosine-derived inhibitor
6FHK 1.66 Å, Structure of a modified protein containing a genetically encoded phosphoserine
3AY9 1.75 Å, Crystal structure of human Hsp70 NBD in the ADP-, Mg ion-, and K ion-bound state

Browse structure collections

About this viewer

MolViewer shows 5BN9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.