6ZYI: HSP70 ATPase domain

Crystal structure of HSP70 ATPase domain in complex with ADP and calcium. Determined by X-ray diffraction at 1.52 Å resolution. Released 16 Dec 2020.

Method: X-ray diffraction
Resolution: 1.52 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,417
Mol. weight: 42.19 kDa
Ligands: ADP, CA
Released: 16 Dec 2020

Explore 6ZYI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ZYI contains 19 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
β-strand	15-22	8	1
β-strand	25-28	4	1
α-helix	29-30	2
β-strand	38-39	2	1
β-strand	42-44	3	2
β-strand	49-51	3	2
α-helix	53-57	5
α-helix	63-65	3
β-strand	66-67	2	2
α-helix	70-72	3
α-helix	81-86	6
α-helix	87-89	3
β-strand	93-97	5	3
β-strand	100-107	8	3
β-strand	110-114	5	3
α-helix	116-135	20
β-strand	141-146	6	1
α-helix	152-164	13
β-strand	168-174	7	1
α-helix	175-182	8
α-helix	185-187	3
β-strand	193-200	8	4
β-strand	205-213	9	4
β-strand	216-225	10	4
α-helix	230-249	20
α-helix	257-273	17
β-strand	279-288	10	5
β-strand	291-298	8	5
α-helix	299-311	13
α-helix	314-324	11
α-helix	328-330	3
β-strand	333-337	5	4
α-helix	339-342	4
α-helix	344-353	10
α-helix	357-359	3
β-strand	360	1	4
α-helix	368-380	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock 70kDa protein 1A variant	A	protein	378	Homo sapiens	P0DMV8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6ZYI_1 Heat shock 70kDa protein 1A variant (chains A)
AAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNP
QNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGDTKAFYPEEISSMV
LTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAY
GLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVE
EFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFE
ELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSI
NPDEAVAYGAAVQAAILM

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
CA	Calcium ion	Ca	2

Primary citation

Calcium depletion challenges endoplasmic reticulum proteostasis by destabilising BiP-substrate complexes. Preissler, S., Rato, C., Yan, Y. et al. Elife (2020) 9. DOI 10.7554/eLife.62601 · PubMed

Other PDB entries of the same protein (UniProt P0DMV8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BN8 1.34 Å, Crystal structure of nucleotide-free human Hsp70 NBD.
6K39 1.4 Å, Structural analysis of AIMP2-DX2 and HSP70 interaction
6G3R 1.4 Å, Structure of tellurium-centred Anderson-Evans polyoxotungstate (TEW) bound to the…
5AQW 1.53 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
3Q49 1.54 Å, Crystal structure of the TPR domain of CHIP complexed with Hsp70-C peptide
5AQY 1.56 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
3ATV 1.58 Å, Crystal structure of human Hsp70 NBD in the ADP-bound and Mg ion-free state
3ATU 1.65 Å, Crystal structure of human Hsp70 NBD in the ADP- and Mg ion-bound state
5AQZ 1.65 Å, HSP72 with adenosine-derived inhibitor
6FHK 1.66 Å, Structure of a modified protein containing a genetically encoded phosphoserine
5BN9 1.69 Å, Crystal structure of ADP bound human Hsp70 NBD mutant R272K.
3AY9 1.75 Å, Crystal structure of human Hsp70 NBD in the ADP-, Mg ion-, and K ion-bound state

Browse structure collections

About this viewer

MolViewer shows 6ZYI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.