Crystal structure of the Dachshund-homology domain of human SKI. Determined by X-ray diffraction at 1.65 Å resolution. Released 25 May 2004.
Explore 1SBX in 3D Show helices and sheets RCSB PDB PDBe
1SBX contains 7 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 89-91 | 3 | |
| α-helix | 93-97 | 5 | |
| β-strand | 101-105 | 5 | 1 |
| β-strand | 108-115 | 8 | 1 |
| β-strand | 118-122 | 5 | 1 |
| α-helix | 123-127 | 5 | |
| α-helix | 136-145 | 10 | |
| α-helix | 148-150 | 3 | |
| β-strand | 151-152 | 2 | 1 |
| α-helix | 155-163 | 9 | |
| β-strand | 175-178 | 4 | 1 |
| α-helix | 179-190 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ski oncogene | A | protein | 106 | Homo sapiens | P12755 (AlphaFold model) |
>1SBX_1 Ski oncogene (chains A) GSHMFMPSDRSTERCETVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINAVCDEL HIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYG
Crystal Structure of the Dachshund Homology Domain of human SKI. Wilson, J.J., Malakhova, M., Zhang, R. et al. Structure (2004) 12:785-792. DOI 10.1016/j.str.2004.02.035 · PubMed
Other PDB entries of the same protein (UniProt P12755 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1SBX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.