6ZVQ: Mothers against decapentaplegic homolog 2

Complex between SMAD2 MH2 domain and peptide from Ski corepressor. Determined by X-ray diffraction at 2.03 Å resolution. Released 9 Jun 2021.

Method: X-ray diffraction
Resolution: 2.03 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,943
Mol. weight: 30.77 kDa
Ligands: TAR
Released: 9 Jun 2021

Explore 6ZVQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ZVQ contains 13 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	275-281	7	1
β-strand	284-285	2	1
α-helix	288-289	2
β-strand	290-292	3	1
β-strand	296-300	5	2
β-strand	310-312	3	2
α-helix	313-315	3
α-helix	323-329	7
β-strand	336-341	6	2
β-strand	344-349	6	2
β-strand	355-358	4	1
α-helix	360-365	6
β-strand	374-376	3	1
β-strand	381-386	6	2
α-helix	387-397	11
α-helix	398-400	3
α-helix	402-406	5
α-helix	407-412	6
β-strand	413-418	6	1
α-helix	431-433	3
β-strand	437-442	6	1
α-helix	443-453	11
α-helix	462-464	3

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	16-27	12
α-helix	35-39	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mothers against decapentaplegic homolog 2	A	protein	227	Homo sapiens	Q15796 (AlphaFold model)
Ski oncogene	B	protein	35	Homo sapiens	P12755 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6ZVQ_1 Mothers against decapentaplegic homolog 2 (chains A)
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS

Sequence of entity 2 (B), FASTA

>6ZVQ_2 Ski oncogene (chains B)
FQPHPGLQKTLEQFHLSSMSSLGGPAAFSARWAQE

Ligands and cofactors

ID	Name	Formula	Copies
TAR	D(-)-tartaric acid	C4 H6 O6	3

Water and common crystallization additives (SO4, GOL) are not listed.

Primary citation

Mutations in SKI in Shprintzen-Goldberg syndrome lead to attenuated TGF-beta responses through SKI stabilization. Gori, I., George, R., Purkiss, A.G. et al. Elife (2021) 10. DOI 10.7554/eLife.63545 · PubMed

Other PDB entries of the same protein (UniProt Q15796 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YIA 1.3 Å, 14-3-3 sigma in complex with SMAD2 pS465 peptide
6M64 1.45 Å, Crystal structure of SMAD2 in complex with CBP
1KHX 1.8 Å, Crystal structure of a phosphorylated Smad2
5XOD 1.85 Å, Crystal structure of human Smad2-Ski complex
1DEV 2.2 Å, Crystal structure of SMAD2 MH2 domain bound to the smad-binding domain of sara
1U7V 2.7 Å, Crystal Structure of the phosphorylated Smad2/Smad4 heterotrimeric complex
5ZOJ 2.79 Å, Crystal structure of human SMAD2-MAN1 complex
7CO1 3.3 Å, Crystal structure of SMAD2 in complex with wild-type CBP
2LB3 Structure of the WW domain of PIN1 in complex with a human phosphorylated Smad3 derived…

Browse structure collections

About this viewer

MolViewer shows 6ZVQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.