5XOD: Human Smad2-Ski complex

Crystal structure of human Smad2-Ski complex. Determined by X-ray diffraction at 1.85 Å resolution. Released 28 Mar 2018.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,738
Mol. weight: 25.63 kDa
Released: 28 Mar 2018

Explore 5XOD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XOD contains 11 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	264-266	3
β-strand	275-281	7	1
β-strand	284-285	2	1
α-helix	288-289	2
β-strand	290-292	3	1
β-strand	296-300	5	2
β-strand	310-312	3	2
α-helix	323-329	7
β-strand	336-341	6	2
β-strand	344-349	6	2
β-strand	355-358	4	1
α-helix	360-364	5
β-strand	373-376	4	1
β-strand	381-386	6	2
α-helix	387-397	11
α-helix	398-400	3
α-helix	402-406	5
α-helix	407-412	6
β-strand	413-418	6	1
α-helix	431-433	3
β-strand	437-442	6	1
α-helix	443-453	11

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	16-27	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mothers against decapentaplegic homolog 2	A	protein	199	Homo sapiens	Q15796 (AlphaFold model)
Ski oncogene	B	protein	31	Homo sapiens	P12755 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5XOD_1 Mothers against decapentaplegic homolog 2 (chains A)
GPDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNV
NRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPG
CNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIE
LHLNGPLQWLDKVLTQMGS

Sequence of entity 2 (B), FASTA

>5XOD_2 Ski oncogene (chains B)
GPGLQKTLEQFHLSSMSSLGGPAAFSASDED

Primary citation

Hydrophobic patches on SMAD2 and SMAD3 determine selective binding to cofactors. Miyazono, K.I., Moriwaki, S., Ito, T. et al. Sci Signal (2018) 11. DOI 10.1126/scisignal.aao7227 · PubMed

Other PDB entries of the same protein (UniProt Q15796 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YIA 1.3 Å, 14-3-3 sigma in complex with SMAD2 pS465 peptide
6M64 1.45 Å, Crystal structure of SMAD2 in complex with CBP
1KHX 1.8 Å, Crystal structure of a phosphorylated Smad2
6ZVQ 2.03 Å, Complex between SMAD2 MH2 domain and peptide from Ski corepressor
1DEV 2.2 Å, Crystal structure of SMAD2 MH2 domain bound to the smad-binding domain of sara
1U7V 2.7 Å, Crystal Structure of the phosphorylated Smad2/Smad4 heterotrimeric complex
5ZOJ 2.79 Å, Crystal structure of human SMAD2-MAN1 complex
7CO1 3.3 Å, Crystal structure of SMAD2 in complex with wild-type CBP
2LB3 Structure of the WW domain of PIN1 in complex with a human phosphorylated Smad3 derived…

Browse structure collections

About this viewer

MolViewer shows 5XOD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.