1SGH: Moesin FERM domain

Moesin FERM domain bound to EBP50 C-terminal peptide. Determined by X-ray diffraction at 3.5 Å resolution. Released 29 Jun 2004.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,482
Mol. weight: 39.56 kDa
Released: 29 Jun 2004

Explore 1SGH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SGH contains 8 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
β-strand	15-18	4	1
β-strand	25	1	2
α-helix	26-36	11
β-strand	45-50	6	1
β-strand	51	1	3
β-strand	56-58	3	1
β-strand	64	1	2
β-strand	70	1	3
β-strand	76-82	7	1
α-helix	89-92	4
α-helix	98-110	13
α-helix	119-131	13
α-helix	155-158	4
α-helix	165-177	13
α-helix	186-195	10
β-strand	204-209	6	4
β-strand	215-221	7	4
β-strand	224-228	5	4
β-strand	238-241	4	4
β-strand	247-251	5	4
β-strand	254-258	5	4
β-strand	267-270	4	4
α-helix	274-295	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Moesin	A	protein	297	Homo sapiens	P26038 (AlphaFold model)
Ezrin-radixin-moesin binding phosphoprotein 50	B	protein	39		O14745 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1SGH_1 Moesin (chains A)
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLK
LNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHR
GMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP

Sequence of entity 2 (B), FASTA

>1SGH_2 Ezrin-radixin-moesin binding phosphoprotein 50 (chains B)
CLDFNISLAMAKERAHQKRSSKRAPQMDWSKKNELFSNL

Primary citation

The EBP50-moesin interaction involves a binding site regulated by direct masking on the FERM domain. Finnerty, C.M., Chambers, D., Ingraffea, J. et al. J Cell Sci (2004) 117:1547-1552. DOI 10.1242/jcs.01038 · PubMed

Other PDB entries of the same protein (UniProt P26038 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8CIS 1.52 Å, The FERM domain of human moesin with two bound peptides identified by phage display
6TXQ 1.73 Å, The high resolution structure of the FERM domain and helical linker of human moesin
8XZ5 1.8 Å, SARS-CoV-2 S and moesin complex structure
8CIR 1.85 Å, The FERM domain of human moesin with a bound peptide identified by phage display
1EF1 1.9 Å, Crystal structure of the moesin ferm domain/tail domain complex
6TXS 2.2 Å, The structure of the FERM domain and helical linker of human moesin bound to a CD44…
8CIU 2.39 Å, The FERM domain of human moesin mutant H288A
8CIT 2.54 Å, The FERM domain of human moesin mutant L281R
1E5W 2.7 Å, Structure of isolated FERM domain and first long helix of moesin

Browse structure collections

About this viewer

MolViewer shows 1SGH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.