Crystal Structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2: an anthrax toxin receptor. Determined by X-ray diffraction at 1.81 Å resolution. Released 13 Apr 2004.
Explore 1SHT in 3D Show helices and sheets RCSB PDB PDBe
1SHT contains 9 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 43-50 | 8 | 1 |
| α-helix | 53-58 | 6 | |
| α-helix | 59-72 | 14 | |
| β-strand | 79-85 | 7 | 1 |
| β-strand | 89-96 | 8 | 1 |
| α-helix | 99-110 | 12 | |
| α-helix | 120-134 | 15 | |
| α-helix | 136-138 | 3 | |
| β-strand | 140-147 | 8 | 1 |
| α-helix | 155-168 | 14 | |
| β-strand | 172-177 | 6 | 1 |
| α-helix | 183-189 | 7 | |
| α-helix | 193-195 | 3 | |
| β-strand | 196-198 | 3 | 1 |
| α-helix | 205-214 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Anthrax toxin receptor 2 | X | protein | 181 | Homo sapiens | P58335 (AlphaFold model) |
>1SHT_1 Anthrax toxin receptor 2 (chains X) GSCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLT GDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVP SYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQ S
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 1 |
Water and common crystallization additives (ACT) are not listed.
Crystal Structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2: an anthrax toxin receptor. Lacy, D.B., Wigelsworth, D.J., Scobie, H.M. et al. Proc Natl Acad Sci U S A (2004) 101:6367-6372. DOI 10.1073/pnas.0401506101 · PubMed
Other PDB entries of the same protein (UniProt P58335 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1SHT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.