8FZV: PDB entry 8FZV

The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Ala-Ala linker variant, expressed with SUMO tag. Determined by X-ray diffraction at 3.29 Å resolution. Released 19 Jul 2023.

Method: X-ray diffraction
Resolution: 3.29 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,021
Mol. weight: 89.16 kDa
Ligands: MG
Released: 19 Jul 2023

Explore 8FZV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8FZV contains 31 α-helices and 12 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
α-helix	18-31	14
α-helix	39-41	3
α-helix	46-49	4
α-helix	54-60	7
α-helix	66-81	16
β-strand	83-90	8	1
α-helix	96-98	3
α-helix	99-110	12
β-strand	118-125	8	1
β-strand	129-136	8	1
α-helix	139-150	12
α-helix	160-174	15
β-strand	181-187	7	1
α-helix	195-208	14
β-strand	212-217	6	1
α-helix	223-229	7
β-strand	236-237	2	1
α-helix	243-249	7

Chain B: 12 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
α-helix	18-31	14
α-helix	46-49	4
α-helix	54-60	7
α-helix	65-79	15
β-strand	84-88	5	2
α-helix	94-97	4
α-helix	99-112	14
β-strand	120-122	3	2
β-strand	133-136	4	2
α-helix	139-151	13
α-helix	160-174	15
β-strand	181-187	7	2
α-helix	195-208	14
β-strand	211-217	7	2
α-helix	223-229	7
β-strand	237	1	2
α-helix	245-252	8

Chain C: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	13-15	3
α-helix	18-31	14
α-helix	39-42	4
α-helix	46-51	6
α-helix	54-60	7
α-helix	65-78	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor ETV6,Anthrax toxin receptor 2	A, B, C	protein	257	Homo sapiens	P41212 (AlphaFold model), P58335 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8FZV_1 Transcription factor ETV6,Anthrax toxin receptor 2 (chains A, B, C)
GSIALPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYR
SPHSGDELYELLQHILAQARAAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRL
SFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTS
SIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYAVGVLDFEQAQLERIADSKEQVFPVK
GGFQALKGIINSILAQS

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (UNX) are not listed.

Primary citation

Increasing the bulk of the 1TEL-target linker and retaining the 10×His tag in a 1TEL-CMG2-vWa construct improves crystal order and diffraction limits. Gajjar, P.L., Pedroza Romo, M.J., Litchfield, C.M. et al. Acta Crystallogr D Struct Biol (2023) 79:925-943. DOI 10.1107/S2059798323007246 · PubMed

Other PDB entries of the same protein (UniProt P41212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DOC 1.19 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
9ZB7 1.24 Å, A DARPin fused to the 1TEL crystallization chaperone via a direct helical fusion
9Q4D 1.3 Å, A DARPin fused to the double trigger 1TEL variant crystallization chaperone via a direct…
7TW9 1.41 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to Sinefungin
1JI7 1.45 Å, Crystal Structure of TEL SAM Polymer
7TDY 1.53 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused…
7TW8 1.55 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAH
8FRJ 1.57 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC0946
9DB5 1.57 Å, A DARPin fused to the 1TEL crystallization chaperone via a proline-alanine linker
8FT8 1.6 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
8FRK 1.61 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC8158
7TW7 1.62 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAM

Browse structure collections

About this viewer

MolViewer shows 8FZV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.