Crystal structure of the PAZ domain of human eIF2c1 in complex with a 9-mer siRNA-like duplex. Determined by X-ray diffraction at 2.6 Å resolution. Released 25 May 2004.
Explore 1SI3 in 3D Show helices and sheets RCSB PDB PDBe
1SI3 contains 6 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 225 | 1 | |
| β-strand | 226-227 | 2 | 1 |
| α-helix | 228-236 | 9 | |
| α-helix | 246-249 | 4 | |
| α-helix | 250-260 | 11 | |
| β-strand | 264-267 | 4 | 1 |
| β-strand | 276-278 | 3 | 1 |
| β-strand | 279-286 | 8 | 2 |
| β-strand | 291-293 | 3 | 3 |
| β-strand | 303-305 | 3 | 3 |
| α-helix | 306-312 | 7 | |
| β-strand | 324-328 | 5 | 2 |
| β-strand | 335-338 | 4 | 2 |
| β-strand | 342-344 | 3 | 1 |
| α-helix | 345-347 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 5'-r(*cp*gp*up*gp*ap*cp*up*cp*u)-3' | B | RNA | 9 | ||
| Eukaryotic translation initiation factor 2C 1 | A | protein | 149 | Homo sapiens | Q9UL18 (AlphaFold model) |
>1SI3_1 5'-R(*CP*GP*UP*GP*AP*CP*UP*CP*U)-3' (chains B) CGUGACUCU
>1SI3_2 Eukaryotic translation initiation factor 2C 1 (chains A) GSHMAQPVIEFMCEVLDIRNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVC NVTRRPASHQTFPLQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLE VCNIVAGQRCIKKLTDNQTSTMIKATARS
Structural basis for overhang-specific small interfering RNA recognition by the PAZ domain. Ma, J.B., Ye, K., Patel, D.J. Nature (2004) 429:318-322. DOI 10.1038/nature02519 · PubMed
Other PDB entries of the same protein (UniProt Q9UL18 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1SI3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.