1SI3: PAZ domain of human eIF2c1

Crystal structure of the PAZ domain of human eIF2c1 in complex with a 9-mer siRNA-like duplex. Determined by X-ray diffraction at 2.6 Å resolution. Released 25 May 2004.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,177
Mol. weight: 20.19 kDa
Released: 25 May 2004

Explore 1SI3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SI3 contains 6 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	225	1
β-strand	226-227	2	1
α-helix	228-236	9
α-helix	246-249	4
α-helix	250-260	11
β-strand	264-267	4	1
β-strand	276-278	3	1
β-strand	279-286	8	2
β-strand	291-293	3	3
β-strand	303-305	3	3
α-helix	306-312	7
β-strand	324-328	5	2
β-strand	335-338	4	2
β-strand	342-344	3	1
α-helix	345-347	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-r(cpgpupgpapcpupcp*u)-3'	B	RNA	9
Eukaryotic translation initiation factor 2C 1	A	protein	149	Homo sapiens	Q9UL18 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1SI3_1 5'-R(*CP*GP*UP*GP*AP*CP*UP*CP*U)-3' (chains B)
CGUGACUCU

Sequence of entity 2 (A), FASTA

>1SI3_2 Eukaryotic translation initiation factor 2C 1 (chains A)
GSHMAQPVIEFMCEVLDIRNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVC
NVTRRPASHQTFPLQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLE
VCNIVAGQRCIKKLTDNQTSTMIKATARS

Primary citation

Structural basis for overhang-specific small interfering RNA recognition by the PAZ domain. Ma, J.B., Ye, K., Patel, D.J. Nature (2004) 429:318-322. DOI 10.1038/nature02519 · PubMed

Other PDB entries of the same protein (UniProt Q9UL18 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4KRE 1.75 Å, Structure of Human Argonaute-1 bound to endogenous Sf9 RNA
4KRF 2.1 Å, Structure of Human Argonaute-1 let-7 complex
4KXT 2.29 Å, Structure of human ARGONAUTE1 in complex with guide RNA
1SI2 2.6 Å, Crystal structure of the PAZ domain of human eIF2c1 in complex with a 9-mer siRNA-like…
5W6V 2.83 Å, The Structure of human Argonaute-1 in complex with the hook motif of human GW182
9Q3F 3.3 Å, Structure of neurodevelopmental mutant AGO1 F180del in complex with guide RNA
9Q3G 3.3 Å, Cryo-EM structure of human AGO1 in complex with guide RNA

Browse structure collections

About this viewer

MolViewer shows 1SI3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.