Structure of Human Argonaute-1 let-7 complex. Determined by X-ray diffraction at 2.1 Å resolution. Released 19 Jun 2013.
Explore 4KRF in 3D Show helices and sheets RCSB PDB PDBe
4KRF contains 39 α-helices and 53 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 22-24 | 3 | |
| β-strand | 25 | 1 | 1 |
| α-helix | 26 | 1 | |
| β-strand | 34-40 | 7 | 2 |
| β-strand | 42-46 | 5 | 3 |
| β-strand | 51-60 | 10 | 4 |
| α-helix | 66-79 | 14 | |
| α-helix | 81-85 | 5 | |
| β-strand | 91-92 | 2 | 4 |
| β-strand | 97-100 | 4 | 4 |
| β-strand | 110-116 | 7 | 4 |
| β-strand | 124-137 | 14 | 4 |
| α-helix | 138-146 | 9 | |
| α-helix | 154-171 | 18 | |
| β-strand | 173-175 | 3 | 3 |
| β-strand | 178-180 | 3 | 3 |
| β-strand | 189-191 | 3 | 3 |
| β-strand | 194-206 | 13 | 3 |
| β-strand | 211-223 | 13 | 3 |
| β-strand | 227 | 1 | 5 |
| α-helix | 228-235 | 8 | |
| α-helix | 247-249 | 3 | |
| α-helix | 250-260 | 11 | |
| β-strand | 264-267 | 4 | 5 |
| β-strand | 276-278 | 3 | 5 |
| β-strand | 279-286 | 8 | 6 |
| β-strand | 291-295 | 5 | 7 |
| β-strand | 301-305 | 5 | 7 |
| α-helix | 306-314 | 9 | |
| β-strand | 324-328 | 5 | 6 |
| β-strand | 335-338 | 4 | 6 |
| α-helix | 339-341 | 3 | |
| β-strand | 342-344 | 3 | 5 |
| α-helix | 345 | 1 | |
| β-strand | 349 | 1 | 3 |
| α-helix | 353-355 | 3 | |
| α-helix | 356-366 | 11 | |
| α-helix | 370-384 | 15 | |
| α-helix | 386-388 | 3 | |
| α-helix | 390-394 | 5 | |
| β-strand | 398-399 | 2 | 3 |
| α-helix | 403 | 1 | |
| β-strand | 404-410 | 7 | 2 |
| α-helix | 411-415 | 5 | |
| β-strand | 416-417 | 2 | 8 |
| β-strand | 419 | 1 | 9 |
| β-strand | 425-426 | 2 | 8 |
| β-strand | 429 | 1 | 10 |
| β-strand | 432 | 1 | 10 |
| β-strand | 439 | 1 | 9 |
| β-strand | 442 | 1 | 11 |
| α-helix | 443-445 | 3 | |
| β-strand | 446 | 1 | 12 |
| β-strand | 449-453 | 5 | 13 |
| α-helix | 462-478 | 17 | |
| β-strand | 483 | 1 | 12 |
| β-strand | 489-492 | 4 | 13 |
| α-helix | 496-498 | 3 | |
| α-helix | 499-509 | 11 | |
| β-strand | 515-520 | 6 | 13 |
| α-helix | 526-531 | 6 | |
| α-helix | 532-538 | 7 | |
| β-strand | 542-546 | 5 | 13 |
| α-helix | 548-551 | 4 | |
| α-helix | 555-568 | 14 | |
| β-strand | 572 | 1 | 11 |
| β-strand | 575-576 | 2 | 8 |
| α-helix | 578-580 | 3 | |
| α-helix | 583-586 | 4 | |
| β-strand | 589-597 | 9 | 2 |
| α-helix | 598-600 | 3 | |
| α-helix | 606-607 | 2 | |
| β-strand | 608-615 | 8 | 2 |
| β-strand | 623-630 | 8 | 2 |
| α-helix | 640-655 | 16 | |
| β-strand | 661-667 | 7 | 2 |
| α-helix | 671-673 | 3 | |
| α-helix | 674-692 | 19 | |
| β-strand | 699-706 | 8 | 2 |
| β-strand | 713-715 | 3 | 2 |
| α-helix | 718-720 | 3 | |
| β-strand | 722 | 1 | 14 |
| β-strand | 727 | 1 | 14 |
| α-helix | 728-729 | 2 | |
| β-strand | 732-734 | 3 | 2 |
| β-strand | 743 | 1 | 1 |
| β-strand | 745-749 | 5 | 2 |
| β-strand | 761-768 | 8 | 2 |
| α-helix | 774-784 | 11 | |
| β-strand | 793 | 1 | 10 |
| α-helix | 799-814 | 16 | |
| α-helix | 837-843 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein argonaute-1 | A | protein | 858 | Homo sapiens | Q9UL18 (AlphaFold model) |
| RNA (5'-r(p*up*gp*ap*gp*gp*up*ap*gp*up*ap*gp*gp*up*up*gp*up*ap*up*ap*gp*up*u)-3') | R | RNA | 22 |
>4KRF_1 Protein argonaute-1 (chains A) AMEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDI KPDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPG EGKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSF FSPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIR NIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLESG QTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQT STMIKATARSAPDRQEEISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYG GRNRAIATPNQGVWDMRGKQFYNGIEIKVWAIACFAPQKQCREEVLKNFTDQLRKISKDA GMPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLG MATQCVQVKNVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVFQQPVIFLGADVTHP PAGDGKKPSITAVVGSMDAHPSRYCATVRVQRPRQEIIEDLSYMVRELLIQFYKSTRFKP TRIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKN ERIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQI LTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKEHDSGEGSHISGQSNGRDPQA LAKAVQVHQDTLRTMYFA
>4KRF_2 RNA (5'-R(P*UP*GP*AP*GP*GP*UP*AP*GP*UP*AP*GP*GP*UP*UP*GP*UP*AP*UP*AP*GP*UP*U)-3') (chains R) UGAGGUAGUAGGUUGUAUAGUU
The making of a slicer: activation of human argonaute-1. Faehnle, C.R., Elkayam, E., Haase, A.D. et al. Cell Rep (2013) 3:1901-1909. DOI 10.1016/j.celrep.2013.05.033 · PubMed
Other PDB entries of the same protein (UniProt Q9UL18 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4KRF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.