5W6V: Human Argonaute-1

The Structure of human Argonaute-1 in complex with the hook motif of human GW182. Determined by X-ray diffraction at 2.83 Å resolution. Released 26 Jul 2017.

Method: X-ray diffraction
Resolution: 2.83 Å
Organisms: Homo sapiens, Spodoptera frugiperda
Chains: 3
Atoms: 6,752
Mol. weight: 103.89 kDa
Released: 26 Jul 2017

Explore 5W6V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5W6V contains 40 α-helices and 53 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 40 helices, 53 β-strands

Element	Residues	Length	Sheet
α-helix	22-24	3
β-strand	25	1	1
α-helix	26	1
β-strand	34-40	7	2
β-strand	42-46	5	3
β-strand	51-60	10	4
α-helix	66-79	14
β-strand	91-92	2	4
β-strand	97-100	4	4
β-strand	111-117	7	4
β-strand	124-137	14	4
α-helix	138-146	9
α-helix	154-171	18
β-strand	173-175	3	3
β-strand	178-180	3	3
β-strand	189-191	3	3
β-strand	194-207	14	3
β-strand	210-223	14	3
β-strand	227	1	5
α-helix	228-236	9
α-helix	247-249	3
α-helix	250-260	11
β-strand	264-267	4	5
β-strand	276-278	3	5
β-strand	281-286	6	6
β-strand	291-292	2	7
β-strand	304-305	2	7
α-helix	306-309	4
β-strand	324-327	4	6
β-strand	336-338	3	6
α-helix	339-341	3
β-strand	342-344	3	5
α-helix	345	1
β-strand	349	1	3
α-helix	353-354	2
α-helix	356-366	11
α-helix	370-384	15
α-helix	386-388	3
α-helix	390-394	5
β-strand	398-399	2	3
α-helix	403	1
β-strand	404-410	7	2
α-helix	411-415	5
β-strand	416-417	2	8
α-helix	418	1
β-strand	419	1	9
β-strand	425-426	2	8
β-strand	429	1	10
β-strand	432	1	10
β-strand	439	1	9
β-strand	442	1	11
β-strand	446	1	12
β-strand	449-453	5	13
α-helix	462-478	17
β-strand	483	1	12
α-helix	486-487	2
β-strand	489-492	4	13
α-helix	496-498	3
α-helix	499-509	11
β-strand	515-520	6	13
α-helix	526-531	6
α-helix	532-538	7
β-strand	542-546	5	13
α-helix	548-551	4
α-helix	555-568	14
β-strand	572	1	11
β-strand	575-576	2	8
α-helix	578-580	3
α-helix	583-586	4
β-strand	589-597	9	2
α-helix	606-607	2
β-strand	608-615	8	2
β-strand	623-630	8	2
α-helix	640-655	16
β-strand	661-667	7	2
α-helix	674-692	19
β-strand	699-706	8	2
β-strand	713-715	3	2
α-helix	718-720	3
β-strand	722	1	14
β-strand	727	1	14
α-helix	728-729	2
β-strand	732-734	3	2
β-strand	743	1	1
β-strand	745-749	5	2
α-helix	760	1
β-strand	761-768	8	2
α-helix	774-784	11
β-strand	793	1	10
α-helix	799-814	16
α-helix	837-843	7
α-helix	845-847	3
α-helix	848-851	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein argonaute-1	A	protein	859	Homo sapiens	Q9UL18 (AlphaFold model)
RNA (5'-r(papapupapupupapapapa)-3')	R	RNA	20	Spodoptera frugiperda
Trinucleotide repeat-containing gene 6A protein	B	protein	24	Homo sapiens	Q8NDV7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5W6V_1 Protein argonaute-1 (chains A)
GAMEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVD
IKPDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIP
GEGKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRS
FFSPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDI
RNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLES
GQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ
TSTMIKATARSAPDRQEEISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQY
GGRNRAIATPNQGVWDMRGKQFYNGIEIKVWAIACFAPQKQCREEVLKNFTDQLRKISKD
AGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLL
GMATQCVQVKNVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVFQQPVIFLGADVTH
PPAGDGKKPSITAVVGSMDAHPSRYCATVRVQRPRQEIIEDLSYMVRELLIQFYKSTRFK
PTRIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADK
NERIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQ
ILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKEHDSGEGSHISGQSNGRDPQ
ALAKAVQVHQDTLRTMYFA

Sequence of entity 2 (R), FASTA

>5W6V_2 RNA (5'-R(P*AP*AP*UP*AP*UP*UP*AP*AP*AP*A)-3') (chains R)
AAUAUUAAAXXXXXXXXXXA

Sequence of entity 3 (B), FASTA

>5W6V_3 Trinucleotide repeat-containing gene 6A protein (chains B)
GATVDNGTSAWGKPIDSGPSWGEP

Primary citation

Multivalent Recruitment of Human Argonaute by GW182. Elkayam, E., Faehnle, C.R., Morales, M. et al. Mol Cell (2017) 67:646-658.e3. DOI 10.1016/j.molcel.2017.07.007 · PubMed

Other PDB entries of the same protein (UniProt Q9UL18 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4KRE 1.75 Å, Structure of Human Argonaute-1 bound to endogenous Sf9 RNA
4KRF 2.1 Å, Structure of Human Argonaute-1 let-7 complex
4KXT 2.29 Å, Structure of human ARGONAUTE1 in complex with guide RNA
1SI2 2.6 Å, Crystal structure of the PAZ domain of human eIF2c1 in complex with a 9-mer siRNA-like…
1SI3 2.6 Å, Crystal structure of the PAZ domain of human eIF2c1 in complex with a 9-mer siRNA-like…
9Q3F 3.3 Å, Structure of neurodevelopmental mutant AGO1 F180del in complex with guide RNA
9Q3G 3.3 Å, Cryo-EM structure of human AGO1 in complex with guide RNA

Browse structure collections

About this viewer

MolViewer shows 5W6V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.