1SSK: Nucleocapsid protein

Structure of the N-terminal RNA-binding Domain of the SARS CoV Nucleocapsid Protein. Determined by solution NMR. Released 8 Jun 2004.

Method: Solution NMR
Organism: SARS coronavirus
Chains: 1
Atoms: 1,213
Mol. weight: 17.18 kDa
Released: 8 Jun 2004

Explore 1SSK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SSK contains 0 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	33-34	2	1
β-strand	35-36	2	2
β-strand	62-68	7	1
β-strand	85-91	7	1
β-strand	108-111	4	1
β-strand	149-150	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleocapsid protein	A	protein	158	SARS coronavirus	P59595 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1SSK_1 Nucleocapsid protein (chains A)
MGSSHHHHHHSSGLVPRGSAMGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDD
QIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTP
KDHIGTRNPNNNAATVLQLPQGTTLPKGFYAEGSRGGS

Primary citation

Structure of the N-Terminal RNA-Binding Domain of the SARS CoV Nucleocapsid Protein. Huang, Q., Yu, L., Petros, A.M. et al. Biochemistry (2004) 43:6059-6063. DOI 10.1021/bi036155b · PubMed

Other PDB entries of the same protein (UniProt P59595 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OFZ 1.17 Å, Ultrahigh Resolution Crystal Structure of RNA Binding Domain of SARS Nucleopcapsid (N…
1X7Q 1.45 Å, Crystal structure of HLA-A*1101 with sars nucleocapsid peptide
2GIB 1.75 Å, Crystal structure of the SARS coronavirus nucleocapsid protein dimerization domain
2OG3 1.85 Å, structure of the rna binding domain of n protein from SARS coronavirus in cubic crystal…
7LG0 2.3 Å, Human leukocyte antigen B*07:02 in complex with SARS-CoV2 epitope SPRWYFYYL
6IEX 2.31 Å, Crystal structure of HLA-B*4001 in complex with SARS-CoV derived peptide N216-225…
3I6L 2.4 Å, Newly identified epitope N1 derived from SARS-CoV N protein complexed with HLA-A*2402
2CJR 2.5 Å, Crystal structure of oligomerization domain of SARS coronavirus nucleocapsid protein.
2JW8 Solution structure of stereo-array isotope labelled (SAIL) C-terminal dimerization…

Browse structure collections

About this viewer

MolViewer shows 1SSK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.