1STC: Camp-dependent protein kinase

Camp-dependent protein kinase, alpha-catalytic subunit in complex with staurosporine. Determined by X-ray diffraction at 2.3 Å resolution. Released 25 Feb 1998.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Bos taurus
Chains: 2
Atoms: 3,087
Mol. weight: 43.48 kDa
Ligands: STU
Released: 25 Feb 1998

Explore 1STC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1STC contains 21 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 19 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	16-31	16
α-helix	40-42	3
β-strand	43-51	9	1
β-strand	55-62	8	1
β-strand	68-75	8	1
α-helix	76-81	6
α-helix	85-95	11
β-strand	103	1	2
β-strand	106-111	6	1
β-strand	115-121	7	1
β-strand	127	1	3
α-helix	128-135	8
α-helix	140-159	20
β-strand	162-163	2	4
α-helix	169-171	3
β-strand	173-174	2	3
β-strand	180-181	2	3
β-strand	182	1	2
β-strand	189-190	2	4
β-strand	195	1	5
α-helix	207-210	4
β-strand	215	1	5
α-helix	218-233	16
α-helix	243-251	9
α-helix	263-272	10
α-helix	277-279	3
α-helix	289-292	4
α-helix	295-297	3
α-helix	302-307	6
α-helix	311-312	2
α-helix	328-329	2
α-helix	331-334	4
α-helix	344-347	4

Chain I: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-13	8
α-helix	18-20	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Camp-dependent protein kinase	E	protein	350	Bos taurus	P00517 (AlphaFold model)
Protein kinase inhibitor	I	protein	20		P61926 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>1STC_1 CAMP-DEPENDENT PROTEIN KINASE (chains E)
GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLV
KHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVM
EYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYI
QVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFA
DQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATT
DWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

Sequence of entity 2 (I), FASTA

>1STC_2 PROTEIN KINASE INHIBITOR (chains I)
TTYADFIASGRTGRRNAIHD

Ligands and cofactors

ID	Name	Formula	Copies
STU	Staurosporine	C28 H26 N4 O3	1

Primary citation

Staurosporine-induced conformational changes of cAMP-dependent protein kinase catalytic subunit explain inhibitory potential. Prade, L., Engh, R.A., Girod, A. et al. Structure (1997) 5:1627-1637. DOI 10.1016/S0969-2126(97)00310-9 · PubMed

Other PDB entries of the same protein (UniProt P00517 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Z84 1.55 Å, PKAB3 in complex with pyrrolidine inhibitor 34a
4C38 1.58 Å, PKA-S6K1 Chimera with compound 21e (CCT239066) bound
1XH8 1.6 Å, Crystal Structures of Protein Kinase B Selective Inhibitors in Complex with Protein…
5VHB 1.61 Å, Crystal structure of Protein Kinase A in complex with the PKI peptide and…
1XH9 1.64 Å, Crystal Structures of Protein Kinase B Selective Inhibitors in Complex with Protein…
3ZO4 1.65 Å, The Synthesis and Evaluation of Diazaspirocyclic Protein Kinase Inhibitors
4C33 1.7 Å, PKA-S6K1 Chimera Apo
4C37 1.7 Å, PKA-S6K1 Chimera with compound 21a (CCT196539) bound
8SF8 1.7 Å, Structure of bovine PKA bound to (R)-N-(4-(1H-pyrrolo[2,3-b]pyridin-4-yl)phenyl)-2-amino-…
4C34 1.78 Å, PKA-S6K1 Chimera with Staurosporine bound
3KKV 1.8 Å, Structure of PKA with a protein Kinase B-selective inhibitor.
4Z83 1.8 Å, PKAB3 in complex with pyrrolidine inhibitor 47a

Browse structure collections

About this viewer

MolViewer shows 1STC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.