Satellite panicum mosaic virus. Determined by X-ray diffraction at 1.9 Å resolution. Released 27 Jan 1997.
Explore 1STM in 3D Show helices and sheets RCSB PDB PDBe
1STM contains 40 α-helices and 50 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 19-20 | 2 | |
| β-strand | 21-29 | 9 | 1 |
| β-strand | 36-40 | 5 | 2 |
| α-helix | 41-43 | 3 | |
| α-helix | 45-49 | 5 | |
| β-strand | 55-66 | 12 | 1 |
| β-strand | 70-76 | 7 | 2 |
| β-strand | 86-87 | 2 | 2 |
| β-strand | 91-93 | 3 | 2 |
| β-strand | 98-102 | 5 | 1 |
| α-helix | 110-111 | 2 | |
| β-strand | 112 | 1 | 1 |
| α-helix | 113 | 1 | |
| β-strand | 121-128 | 8 | 2 |
| α-helix | 134-137 | 4 | |
| β-strand | 139-149 | 11 | 1 |
| α-helix | 150-152 | 3 | |
| α-helix | 154-156 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Satellite panicum mosaic virus | A, B, C, D, E | protein | 157 | Panicum mosaic satellite virus | Q86993 (AlphaFold model) |
>1STM_1 SATELLITE PANICUM MOSAIC VIRUS (chains A, B, C, D, E) MAPKRSRRSNRRAGSRAAATSLVYDTCYVTLTERATTSFQRQSFPTLKGMGDRAFQVVAF TIQGVSAAPLMYNARLYNPGDTDSVHATGVQLMGTVPRTVRLTPRVGQNNWFFGNTEEAE TILAIDGLVSTKGANAPSNTVIVTGCFRLAPSELQSS
The structure of satellite panicum mosaic virus at 1.9 A resolution. Ban, N., McPherson, A. Nat Struct Biol (1995) 2:882-890. DOI 10.1038/nsb1095-882 · PubMed
Other PDB entries of the same protein (UniProt Q86993 (AlphaFold model), which also has an AlphaFold model), best resolution first:
1STM is part of these collections:
MolViewer shows 1STM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.