Investigation of RNA structure in satellite panicum mosaic virus - glutaraldehyde treated. Determined by X-ray diffraction at 3.3 Å resolution. Released 11 Oct 2017.
Explore 5CVZ in 3D Show helices and sheets RCSB PDB PDBe
5CVZ contains 7 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 19-20 | 2 | |
| β-strand | 21-29 | 9 | 1 |
| β-strand | 36-40 | 5 | 2 |
| α-helix | 41-43 | 3 | |
| α-helix | 45-49 | 5 | |
| β-strand | 55-66 | 12 | 1 |
| β-strand | 71-77 | 7 | 2 |
| β-strand | 84-87 | 4 | 2 |
| β-strand | 91-92 | 2 | 2 |
| β-strand | 98-102 | 5 | 1 |
| α-helix | 110-111 | 2 | |
| β-strand | 112 | 1 | 1 |
| α-helix | 113 | 1 | |
| β-strand | 121-128 | 8 | 2 |
| β-strand | 139-149 | 11 | 1 |
| α-helix | 150-152 | 3 | |
| α-helix | 154-156 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Coat protein | A | protein | 141 | Panicum mosaic satellite virus | Q86993 (AlphaFold model) |
>5CVZ_1 Coat protein (chains A) AAATSLVYDTCYVTLTERATTSFQRQSFPTLKGMGDRAFQVVAFTIQGVSAAPLMYNARL YNPGDTDSVHATGVQLMGTVPRTVRLTPRVGQNNWFFGNTEEAETILAIDGLVSTKGANA PSNTVIVTGCFRLAPSELQSS
Investigation of RNA structure in satellite panicum mosaic virus. Makino, D.L., Day, J., Larson, S.B. et al. Virology (2006) 351:420-431. DOI 10.1016/j.virol.2006.03.028 · PubMed
Other PDB entries of the same protein (UniProt Q86993 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5CVZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.