1STP: Streptavidin complex with biotin

Structural origins of high-affinity biotin binding to streptavidin. Determined by X-ray diffraction at 2.6 Å resolution. Released 15 Oct 1992.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Streptomyces avidinii
Chains: 1
Atoms: 1,001
Mol. weight: 16.75 kDa
Ligands: BTN
Released: 15 Oct 1992

Explore 1STP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1STP contains 3 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	14-17	4
β-strand	19-23	5	1
β-strand	28-33	6	1
β-strand	38-44	7	1
β-strand	54-60	7	1
α-helix	69-70	2
β-strand	71-80	10	1
β-strand	85-97	13	1
β-strand	103-112	10	1
α-helix	116-121	6
β-strand	123-131	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Streptavidin complex with biotin	A	protein	159	Streptomyces avidinii	P22629 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1STP_1 STREPTAVIDIN COMPLEX WITH BIOTIN (chains A)
DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRY
DSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAW
KSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ

Ligands and cofactors

ID	Name	Formula	Copies
BTN	Biotin	C10 H16 N2 O3 S	1

Primary citation

Structural origins of high-affinity biotin binding to streptavidin. Weber, P.C., Ohlendorf, D.H., Wendoloski, J.J. et al. Science (1989) 243:85-88. PubMed

Other PDB entries of the same protein (UniProt P22629 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2F01 0.85 Å, Epi-biotin complex with core streptavidin
9PUA 0.94 Å, L-Biotin-streptavidin binding
3RY2 0.95 Å, Wild-type core streptavidin-biotin complex at atomic resolution
9PUB 0.95 Å, Biotin-streptavidin binding
1LUQ 0.96 Å, Full Matrix Error Analysis of Streptavidin
2GH7 1.0 Å, Epi-biotin complex with core streptavidin
3WYQ 1.0 Å, Crystal structure of the low-immunogenic core streptavidin mutant LISA-314…
4GDA 1.0 Å, Circular Permuted Streptavidin A50/N49
6T2L 1.0 Å, Streptavidin variants harbouring an artificial organocatalyst based cofactor
3RY1 1.03 Å, Wild-type core streptavidin at atomic resolution
5N8B 1.03 Å, Crystal structure of streptavidin with peptide afpdylaeyhgg
5N8J 1.05 Å, CRYSTAL STRUCTURE OF STREPTAVIDIN WITH PEPTIDE D-amino acid containing peptide…

Browse more

1STP is part of these collections:

Classic small proteins for teaching

About this viewer

MolViewer shows 1STP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.