L-Biotin-streptavidin binding. Determined by X-ray diffraction at 0.94 Å resolution. Released 3 Sept 2025.
Explore 9PUA in 3D Show helices and sheets RCSB PDB PDBe
9PUA contains 4 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 19-23 | 5 | 1 |
| β-strand | 28-33 | 6 | 1 |
| β-strand | 38-44 | 7 | 1 |
| β-strand | 54-60 | 7 | 1 |
| α-helix | 70 | 1 | |
| β-strand | 71-80 | 10 | 1 |
| β-strand | 85-97 | 13 | 1 |
| β-strand | 103-112 | 10 | 1 |
| α-helix | 116-121 | 6 | |
| β-strand | 123-132 | 10 | 1 |
| α-helix | 133-134 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 19-23 | 5 | 2 |
| β-strand | 28-33 | 6 | 2 |
| β-strand | 38-44 | 7 | 2 |
| β-strand | 53-60 | 8 | 2 |
| β-strand | 71-80 | 10 | 2 |
| β-strand | 85-97 | 13 | 2 |
| β-strand | 103-112 | 10 | 2 |
| α-helix | 119-121 | 3 | |
| β-strand | 123-131 | 9 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Streptavidin | J, L | protein | 127 | Streptomyces avidinii | P22629 (AlphaFold model) |
>9PUA_1 Streptavidin (chains J, L) AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTA LGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTK VKPSAAS
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1CK6 | 5-[(3aR,4R,6aS)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanoic acid | C10 H16 N2 O3 S | 2 |
Water and common crystallization additives (GOL) are not listed.
Protein chirality as a determinant of ligand affinity: insights from l- and d-streptavidin. Giesler, R.J., Woodham, P.C.S., Draper, S.R.E. et al. Chem Sci (2025) 16:23342-23350. DOI 10.1039/d5sc06380a · PubMed
Other PDB entries of the same protein (UniProt P22629 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9PUA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.