1SWZ: Lysozyme

Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure determination by direct methods. Determined by X-ray diffraction at 1.06 Å resolution. Released 18 Jan 2005.

Method: X-ray diffraction
Resolution: 1.06 Å
Organism: Enterobacteria phage T4
Chains: 1
Atoms: 1,767
Mol. weight: 19.41 kDa
Ligands: RB, PO4
Released: 18 Jan 2005

Explore 1SWZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SWZ contains 10 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-11	9
β-strand	14-15	2	1
β-strand	16	1	2
β-strand	17-19	3	1
β-strand	25-28	4	1
β-strand	31-32	2	1
α-helix	39-50	12
β-strand	57	1	2
α-helix	60-79	20
α-helix	84-90	7
α-helix	93-106	14
α-helix	108-112	5
α-helix	115-122	8
α-helix	126-133	8
α-helix	137-141	5
α-helix	143-155	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lysozyme	A	protein	164	Enterobacteria phage T4	P00720

Sequence of entity 1 (A), FASTA

>1SWZ_1 Lysozyme (chains A)
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITK
DEAEKLFNQDVAAAVRGILRNAKLKPVYDSLDAVRECALINMVFQMGETGVAGFTNSLRM
LQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Ligands and cofactors

ID	Name	Formula	Copies
RB	Rubidium ion	Rb	5
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (BME, CL) are not listed.

Primary citation

Use of an ion-binding site to bypass the 1000-atom limit to structure determination by direct methods. Mooers, B.H., Matthews, B.W. Acta Crystallogr D Biol Crystallogr (2004) 60:1726-1737. DOI 10.1107/S0907444904017020 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SX2 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Structure Determination by…

Browse structure collections

About this viewer

MolViewer shows 1SWZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.